Recombinant Rabbit CD40LG Protein
Cat.No. : | CD40LG-02R |
Product Overview : | The Rabbit CD40LG recombinant protein without tag was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | Yeast |
Description : | CD40 Ligand (CD40LG) is a transmembrane protein that is a member of the TNF superfamily. In addition to existing in a membrane bound form, CD40LG can also be released as a soluble molecule (sCD40LG), which has been shown to have biological functions. CD40 interacts with CD40 ligand (aka CD40LG, TNFSF5 or CD154), which is predominantly expressed on activated CD4+ T-cells. CD40LG is transiently expressed on activated T-cells and plays a crucial role in B-cell function. Activated T-cells expressing CD40LG can also interact with CD40 on endothelial cells to induce production of inflammatory cytokines. The transient expression of CD40LG allows T-cells to stimulate selected CD40-bearing cells to participate in the immune response. Increased levels of sCD40LG have been measured in patients with SLE, RA, inflammatory bowel diseases, systemic sclerosis, and Sjogren's syndrome. In culture, canine sCD40LG was shown to promote the maturation and activation of canine monocyte derived Dendritic cells. |
Molecular Mass : | 16.2 kDa |
AA Sequence : | MQKGDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKL(149) |
Applications : | The Rabbit CD40LG endotoxin-free recombinant protein can be used in cell culture, as an ELISA Standard, and as a Western Blot Control. |
Gene Name | CD40LG CD40 ligand [ Oryctolagus cuniculus (rabbit) ] |
Official Symbol | CD40LG |
Synonyms | CD40LG; CD40 ligand; TNLG8B; CD40 ligand; tumor necrosis factor ligand 8B |
Gene ID | 100358388 |
mRNA Refseq | NM_001256781 |
Protein Refseq | NP_001243710 |
UniProt ID | G1SKP7 |
◆ Recombinant Proteins | ||
CD40LG-280H | Active Recombinant Human CD40LG protein, hFc&Avi-tagged, Biotinylated | +Inquiry |
CD40LG-634H | Recombinant Human CD40LG Protein | +Inquiry |
CD40LG-197H | Recombinant Human CD40LG Protein, C-His-tagged | +Inquiry |
Cd40lg-545RAF647 | Recombinant Rat Cd40lg Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
CD40LG-166CAF488 | Recombinant Canine CD40LG Protein, Gly/Pro-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD40LG-1080CCL | Recombinant Cynomolgus CD40LG cell lysate | +Inquiry |
CD40LG-001CCL | Recombinant Canine CD40LG cell lysate | +Inquiry |
CD40LG-1205RCL | Recombinant Rat CD40LG cell lysate | +Inquiry |
CD40LG-1965HCL | Recombinant Human CD40LG cell lysate | +Inquiry |
CD40LG-1548MCL | Recombinant Mouse CD40LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD40LG Products
Required fields are marked with *
My Review for All CD40LG Products
Required fields are marked with *
0
Inquiry Basket