Recombinant Rat PCSK9 Protein, His-tagged
Cat.No. : | PCSK9-413R |
Product Overview : | Recombinant Rat PCSK9 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | HEK293 |
Tag : | His |
Protein Length : | 691 |
Description : | Predicted to enable several functions, including lipoprotein particle binding activity; lipoprotein particle receptor binding activity; and serine-type endopeptidase activity. Involved in several processes, including cellular response to insulin stimulus; cholesterol homeostasis; and protein autoprocessing. Located in extracellular space and rough endoplasmic reticulum. Human ortholog(s) of this gene implicated in familial hypercholesterolemia and hypobetalipoproteinemia. Orthologous to human PCSK9 (proprotein convertase subtilisin/kexin type 9). |
Form : | Lyophilized |
Molecular Mass : | 73.2 kDa |
AA Sequence : | MGIRCSTWLRWPLSPQLLLLLLLCPTGSRAQDEDGDYEELMLALPSQEDSLVDEASHVATATFRRCSKEAWRLPGTYVVVLMEETQRLQVEQTAHRLQTWAARRGYVIKVLHVFYDLFPGFLVKMSSDLLGLALKLPHVEYIEEDSLVFAQSIPWNLERIIPAWQQTEEDSSPDGSSQVEVYLLDTSIQSGHREIEGRVTITDFNSVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGTSLHSLRVLNCQGKGTVSGTLIGLEFIRKSQLIQPSGPLVVLLPLAGGYSRILNTACQRLARTGVVLVAAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGKDIIGASSDCSTCYMSQSGTSQAAAHVAGIVAMMLNRDPALTLAELRQRLILFSTKDVINMAWFPEDQRVLTPNRVATLPPSTQETGGQLLCRTVWSAHSGPTRTATATARCAPEEELLSCSSFSRSGRRRGDRIEAIGGQQVCKALNAFGGEGVYAVARCCLLPRVNCSIHNTPAARAGPQTPVHCHQKDHVLTGCSFHWEVENLRAQQQPLLRSRHQPGQCVGHQEASVHASCCHAPGLECKIKEHGIAGPAEQVTVACEAGWTLTGCNVLPGASLPLGAYSVDNVCVARIRDAGRADRTSEEATVAAAICCRSRPSAKASWVHQ |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | Pcsk9 proprotein convertase subtilisin/kexin type 9 [ Rattus norvegicus ] |
Official Symbol | PCSK9 |
Synonyms | PCSK9; proprotein convertase subtilisin/kexin type 9; proprotein convertase 9; proprotein convertase PC9; subtilisin/kexin-like protease PC9; neural apoptosis regulated convertase 1; neural apoptosis-regulated convertase 1; PC9; Narc1; NARC-1; |
Gene ID | 298296 |
mRNA Refseq | NM_199253 |
Protein Refseq | NP_954862 |
UniProt ID | P59996 |
◆ Recombinant Proteins | ||
Pcsk9-1156R | Recombinant Rat Pcsk9 protein, His & GST-tagged | +Inquiry |
PCSK9-410H | Recombinant Human PCSK9 Protein, His-tagged | +Inquiry |
PCSK9-206H | Recombinant Human PCSK9 Protein, His\HA\Avi-tagged | +Inquiry |
PCSK9-4311R | Recombinant Rat PCSK9 Protein | +Inquiry |
PCSK9-2138H | Recombinant Human PCSK9 protein (Met1-Gln692(D374Y)), mFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCSK9-2306RCL | Recombinant Rat PCSK9 cell lysate | +Inquiry |
PCSK9-2564MCL | Recombinant Mouse PCSK9 cell lysate | +Inquiry |
PCSK9-2875HCL | Recombinant Human PCSK9 cell lysate | +Inquiry |
PCSK9-2775RCL | Recombinant Rhesus PCSK9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PCSK9 Products
Required fields are marked with *
My Review for All PCSK9 Products
Required fields are marked with *
0
Inquiry Basket