Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Description : |
Human Interleukin-13 (IL-13) is expressed by the IL13 gene located on the chromosome 5 and secreted by many cell types, especially T helper type 2 (Th2) cells. The high solution from of IL-13 reported to be a monomer with two internal disulfide bonds that contribute to a bundled four α-helix configuration. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1beta, TNF-alpha, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching resulting in increased production of IgE. Human, mouse and rat IL-3 share low homology, but have cross species activity. |
Form : |
Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4 with 5 % trehalose. |
Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 1 ng/ml, corresponding to a specific activity of > 1.0 × 10^6 IU/mg. |
Molecular Mass : |
Approximately 12.5 kDa, a single non-glycosylated polypeptide chain containing 112 amino acids. |
AA Sequence : |
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN |
Endotoxin : |
Less than 1 EU/µg of rHuIL-13 as determined by LAL method. |
Purity : |
> 97 % by SDS-PAGE and HPLC analyses. |
Storage : |
This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Reconstitution : |
Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Quality Statement : |
Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing. |
Shipping : |
The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |