Active GMP Recombinant Human IL12A protein
Cat.No. : | IL13-4328HG |
Product Overview : | Recombinant Human IL12A was produced in E. coli using non-animal reagents in an animal-free facility under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | Human Interleukin-13 (IL-13) is expressed by the IL13 gene located on the chromosome 5 and secreted by many cell types, especially T helper type 2 (Th2) cells. The high solution from of IL-13 reported to be a monomer with two internal disulfide bonds that contribute to a bundled four α-helix configuration. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1beta, TNF-alpha, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching resulting in increased production of IgE. Human, mouse and rat IL-3 share low homology, but have cross species activity. |
Form : | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4 with 5 % trehalose. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 1 ng/ml, corresponding to a specific activity of > 1.0 × 10^6 IU/mg. |
Molecular Mass : | Approximately 12.5 kDa, a single non-glycosylated polypeptide chain containing 112 amino acids. |
AA Sequence : | GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN |
Endotoxin : | Less than 1 EU/µg of rHuIL-13 as determined by LAL method. |
Purity : | > 97 % by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Reconstitution : | Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Quality Statement : | Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | IL13 interleukin 13 [ Homo sapiens ] |
Official Symbol | IL13 |
Synonyms | IL13; interleukin 13; interleukin-13; allergic rhinitis; ALRH; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; MGC116786; MGC116788; MGC116789; P600; Bronchial hyperresponsiveness-1 (bronchial asthma); IL-13; |
Gene ID | 3596 |
mRNA Refseq | NM_002188 |
Protein Refseq | NP_002179 |
MIM | 147683 |
UniProt ID | P35225 |
◆ Recombinant Proteins | ||
Il13-87R | Recombinant Rat Il13 protein | +Inquiry |
IL13-52H | Active Recombinant Human Interleukin 13, HIgG1 Fc-tagged | +Inquiry |
IL13-143H | Recombinant Active Human IL13 Protein, His-tagged(C-ter) | +Inquiry |
Il13-089M | Recombinant Mouse Il13 Protein | +Inquiry |
IL13-4307H | Recombinant Human IL13 Protein (Gly35-Asn146), C-Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL13-2922HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-001HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-1336MCL | Recombinant Mouse IL13 cell lysate | +Inquiry |
IL13-1894CCL | Recombinant Cynomolgus IL13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL13 Products
Required fields are marked with *
My Review for All IL13 Products
Required fields are marked with *
0
Inquiry Basket