Recombinant Human IL13

Cat.No. : IL13-28497TH
Product Overview : Full length Human Recombinant IL13 is a single, non-glycosylated polypeptide chain containing 112 amino acids. M.Wt 12 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4.
Form : Lyophilised:Reconstitutein sterile 18MOhm/cm water at not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: PBS, pH 7.2
Storage : Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTA GMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQ FSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN.
Sequence Similarities : Belongs to the IL-4/IL-13 family.
Full Length : Full L.
Gene Name IL13 interleukin 13 [ Homo sapiens ]
Official Symbol IL13
Synonyms IL13; interleukin 13; interleukin-13; allergic rhinitis; ALRH; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; MGC116786; MGC116788; MGC116789; P600;
Gene ID 3596
mRNA Refseq NM_002188
Protein Refseq NP_002179
MIM 147683
Uniprot ID P35225
Chromosome Location 5q31
Pathway Asthma, organism-specific biosystem; Asthma, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem;
Function cytokine activity; interleukin-13 receptor binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL13 Products

Required fields are marked with *

My Review for All IL13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon