Recombinant Human IL13
Cat.No. : | IL13-28497TH |
Product Overview : | Full length Human Recombinant IL13 is a single, non-glycosylated polypeptide chain containing 112 amino acids. M.Wt 12 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. |
Source : | E. coli |
Form : | Lyophilised:Reconstitutein sterile 18MOhm/cm water at not less than 100μg/ml, which can then be further diluted to other aqueous solutions. |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: PBS, pH 7.2 |
Storage : | Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTA GMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQ FSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN. |
Sequence Similarities : | Belongs to the IL-4/IL-13 family. |
Gene Name : | IL13 interleukin 13 [ Homo sapiens ] |
Official Symbol : | IL13 |
Synonyms : | IL13; interleukin 13; interleukin-13; allergic rhinitis; ALRH; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; MGC116786; MGC116788; MGC116789; P600; |
Gene ID : | 3596 |
mRNA Refseq : | NM_002188 |
Protein Refseq : | NP_002179 |
MIM : | 147683 |
Uniprot ID : | P35225 |
Chromosome Location : | 5q31 |
Pathway : | Asthma, organism-specific biosystem; Asthma, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; |
Function : | cytokine activity; interleukin-13 receptor binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
IL13-1002H | Recombinant Human IL13 Protein, His-tagged | +Inquiry |
Il13-49M | Active Recombinant Mouse Il13 Protein (Pro22-Fhe131), C-His tagged, Animal-free, Carrier-free | +Inquiry |
Il13-090M | Active Recombinant Mouse Il13 Protein | +Inquiry |
IL13-132H | Active Recombinant Human IL13 Protein | +Inquiry |
Il13-1661R | Recombinant Rat Il13 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
IL13-2922HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-1894CCL | Recombinant Cynomolgus IL13 cell lysate | +Inquiry |
IL13-1336MCL | Recombinant Mouse IL13 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket