Recombinant Human IL13

• Cat.No.: IL13-28497TH
• Product Overview: Full length Human Recombinant IL13 is a single, non-glycosylated polypeptide chain containing 112 amino acids. M.Wt 12 kDa.

Specification

• Description: This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4.
• Source: E. coli
• Form: Lyophilised:Reconstitutein sterile 18MOhm/cm water at not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: PBS, pH 7.2
• Storage: Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTA GMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQ FSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN.
• Sequence Similarities: Belongs to the IL-4/IL-13 family.

Gene Information

• Gene Name: IL13 interleukin 13 [ Homo sapiens ]
• Official Symbol: IL13
• Synonyms: IL13; interleukin 13; interleukin-13; allergic rhinitis; ALRH; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; MGC116786; MGC116788; MGC116789; P600
• Gene ID: 3596
• mRNA Refseq: NM_002188
• Protein Refseq: NP_002179
• MIM: 147683
• Uniprot ID: P35225
• Chromosome Location: 5q31
• Pathway: Asthma, organism-specific biosystem; Asthma, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem
• Function: cytokine activity; interleukin-13 receptor binding; protein binding