Recombinant Human IL13 protein, hFc-Myc-tagged
| Cat.No. : | IL13-4324H |
| Product Overview : | Recombinant Human IL13 protein(P35225)(21-132aa), fused to C-terminal hFc tag and Myc tag, was expressed in Mammalian cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Fc&Myc |
| Protein Length : | 21-132aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 42 kDa |
| AA Sequence : | TVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDL |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | IL13 interleukin 13 [ Homo sapiens ] |
| Official Symbol | IL13 |
| Synonyms | IL13; interleukin 13; interleukin-13; allergic rhinitis; ALRH; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; MGC116786; MGC116788; MGC116789; P600; Bronchial hyperresponsiveness-1 (bronchial asthma); IL-13; |
| Gene ID | 3596 |
| mRNA Refseq | NM_002188 |
| Protein Refseq | NP_002179 |
| MIM | 147683 |
| UniProt ID | P35225 |
| ◆ Recombinant Proteins | ||
| IL13-255I | Active Recombinant Human IL13 Protein | +Inquiry |
| Il13-088M | Recombinant Mouse Il13 Protein | +Inquiry |
| IL13-4325H | Recombinant Human IL13 protein, hFc-tagged | +Inquiry |
| IL13-58C | Recombinant Chicken IL-13 | +Inquiry |
| IL13-165H | Recombinant Human IL13 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL13-1336MCL | Recombinant Mouse IL13 cell lysate | +Inquiry |
| IL13-1894CCL | Recombinant Cynomolgus IL13 cell lysate | +Inquiry |
| IL13-2922HCL | Recombinant Human IL13 cell lysate | +Inquiry |
| IL13-001HCL | Recombinant Human IL13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL13 Products
Required fields are marked with *
My Review for All IL13 Products
Required fields are marked with *
