Active Recombinant Mouse Btc Protein
Cat.No. : | Btc-193B |
Product Overview : | Recombinant Mouse Btc Protein without tag was expressed in HEK 293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Description : | Betacellulin, also known as BTC, belongs to the EGF family of growth factors. It is expressed in many tissues, such as kidney, pancreas and small intestine. Betacellulin is initially synthesized as a membrane-bound precursor containing multiple EGF-like domains in its extracellular region, and is released from the membrane by proteolytic cleavage. BTC is the ligand for EGFR/ErbB receptor tyrosine kinases, and plays a role in cell growth and differentiation. BTC has been reported to promote beta cell growth and differentiation in the pancreas. Pancreas-specific expression of this gene may induce islet neogenesis and remediate hyperglycemia in type I diabetes. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.08 ng/mL, measured in a cell proliferation assay using 3T3 cells. |
Molecular Mass : | 19-24 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant murine Betacellulin remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Murine Betacellulin should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Btc betacellulin, epidermal growth factor family member [ Mus musculus ] |
Official Symbol | Btc |
Synonyms | BTC; betacellulin, epidermal growth factor family member; betacellulin; probetacellulin; Bcn; |
Gene ID | 12223 |
mRNA Refseq | NM_007568 |
Protein Refseq | NP_031594 |
UniProt ID | Q05928 |
◆ Recombinant Proteins | ||
BTC-208R | Active Recombinant Rhesus BTC protein, hFc-tagged | +Inquiry |
Btc-193B | Active Recombinant Mouse Btc Protein | +Inquiry |
BTC-569H | Recombinant Human BTC, His tagged | +Inquiry |
RFL14405HF | Recombinant Full Length Human Probetacellulin(Btc) Protein, His-Tagged | +Inquiry |
Btc-5414M | Recombinant Mouse Btc Protein (Asp32-Gln118), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTC-933HCL | Recombinant Human BTC cell lysate | +Inquiry |
BTC-1049CCL | Recombinant Cynomolgus BTC cell lysate | +Inquiry |
BTC-2505MCL | Recombinant Mouse BTC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Btc Products
Required fields are marked with *
My Review for All Btc Products
Required fields are marked with *
0
Inquiry Basket