Active Recombinant Mouse Btc Protein

Cat.No. : Btc-193B
Product Overview : Recombinant Mouse Btc Protein without tag was expressed in HEK 293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Description : Betacellulin, also known as BTC, belongs to the EGF family of growth factors. It is expressed in many tissues, such as kidney, pancreas and small intestine. Betacellulin is initially synthesized as a membrane-bound precursor containing multiple EGF-like domains in its extracellular region, and is released from the membrane by proteolytic cleavage. BTC is the ligand for EGFR/ErbB receptor tyrosine kinases, and plays a role in cell growth and differentiation. BTC has been reported to promote beta cell growth and differentiation in the pancreas. Pancreas-specific expression of this gene may induce islet neogenesis and remediate hyperglycemia in type I diabetes.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.08 ng/mL, measured in a cell proliferation assay using 3T3 cells.
Molecular Mass : 19-24 kDa, observed by reducing SDS-PAGE.
AA Sequence : DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant murine Betacellulin remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Murine Betacellulin should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Btc betacellulin, epidermal growth factor family member [ Mus musculus ]
Official Symbol Btc
Synonyms BTC; betacellulin, epidermal growth factor family member; betacellulin; probetacellulin; Bcn;
Gene ID 12223
mRNA Refseq NM_007568
Protein Refseq NP_031594
UniProt ID Q05928

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Btc Products

Required fields are marked with *

My Review for All Btc Products

Required fields are marked with *

0
cart-icon