Recombinant Human BTC protein
Cat.No. : | BTC-21H |
Product Overview : | Recombinant Human BTC protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 80 |
Description : | Betacellulin (BTC) is a member of the EGF family of cytokines that also includes EGF, TGF-a, Amphiregulin, HB-EGF, Epiregulin, Tomoregulin and the Neuregulins. It is expressed in most tissues including kidney, uterus, liver and pancreas. BTC also presents in body fluids, including serum, milk, and colostrum. At the amino acid sequence level, human mature BTC protein exhibits 80 % identity with mouse BTC protein. The protein binds to EGFR, ERBB4 and other EGF receptor family members and acts as a potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 10⁷ IU/mg. |
Molecular Mass : | Recombinant human Betacellulin is a 9.0 kDa monomeric protein, containing 80 amino residues, which comprises the mature EGF homologous portion of the Betacellulin protein. |
AA Sequence : | DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY |
Endotoxin : | Less than 1 EU/µg of rHuBTC as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | BTC |
Official Symbol | BTC |
Synonyms | BTC; betacellulin; probetacellulin; |
Gene ID | 685 |
mRNA Refseq | NM_001729 |
Protein Refseq | NP_001720 |
MIM | 600345 |
UniProt ID | P35070 |
◆ Recombinant Proteins | ||
BTC-395H | Active Recombinant Human BTC protein(Met1-Tyr111), hFc-tagged | +Inquiry |
BTC-320B | Active Recombinant Bovine Betacellulin | +Inquiry |
BTC-569H | Recombinant Human BTC, His tagged | +Inquiry |
BTC-3912Z | Recombinant Zebrafish BTC | +Inquiry |
BTC-1665HF | Recombinant Full Length Human BTC Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTC-2505MCL | Recombinant Mouse BTC cell lysate | +Inquiry |
BTC-933HCL | Recombinant Human BTC cell lysate | +Inquiry |
BTC-1049CCL | Recombinant Cynomolgus BTC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTC Products
Required fields are marked with *
My Review for All BTC Products
Required fields are marked with *
0
Inquiry Basket