Active Recombinant Human Calprotectin S100A9 Protein
| Cat.No. : | S100A9-1019H | 
| Product Overview : | Recombinant Human S100 calcium binding protein A9 antigen is produced by E.coli expression system and the target gene encoding Thr2-Pro114 is expressed. Predicted molecular weight: 13 kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | Non | 
| Protein Length : | 2-114 a.a. | 
| Antigen Description : | Calprotectin belongs to the family of S100 proteins and is composed of two subunits S100A8 and S100A9. Increased plasma concentrations are found in response to infections and inflammation. Faecal calprotectin measurement is used for detection of gastrointestinal inflammation or neoplasia and for assessment of inflammatory bowel disease activity and response to treatment. | 
| Description : | Calprotectin belongs to the family of S100 proteins and is composed of two subunits S100A8 and S100A9. Increased plasma concentrations are found in response to infections and inflammation. Faecal calprotectin measurement is used for detection of gastrointestinal inflammation or neoplasia and for assessment of inflammatory bowel disease activity and response to treatment. | 
| Form : | Lyophilized | 
| Bio-activity : | Anti-h Calprotectin 3403: + Anti-h Calprotectin 3404: - Anti-h Calprotectin 3405: - Anti-h Calprotectin 3406: - Anti-h Calprotectin 3407: - | 
| Molecular Mass : | 13kDa | 
| AA Sequence : | TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDL DTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP | 
| Purity : | >90% by SDS-PAGE | 
| Storage : | -20centigrade | 
| Concentration : | 0.5 mg/ml when reconstituted with 1000 µl of deionized water | 
| Storage Buffer : | PBS, pH 7.4 | 
| Reconstitution : | Reconstitute lyophilized protein with 1000 µl of deionized water | 
| Gene Name | S100A9 S100 calcium binding protein A9 [ Homo sapiens ] | 
| Official Symbol | S100A9 | 
| Synonyms | S100A9; S100 calcium binding protein A9; CAGB, CFAG, S100 calcium binding protein A9 (calgranulin B) , S100 calcium binding protein A9 (calgranulin B); protein S100-A9; 60B8AG; CGLB; LIAG; MAC387; MIF; MRP14; NIF; P14; MRP-14; calgranulin B; calgranulin-B; calprotectin L1H subunit; leukocyte L1 complex heavy chain; migration inhibitory factor-related protein 14; S100 calcium-binding protein A9 (calgranulin B); CAGB; CFAG; L1AG; | 
| Gene ID | 6280 | 
| mRNA Refseq | NM_002965 | 
| Protein Refseq | NP_002956 | 
| MIM | 123886 | 
| UniProt ID | P06702 | 
| ◆ Recombinant Proteins | ||
| S100a9-7331M | Recombinant Mouse S100a9 Protein, His-tagged | +Inquiry | 
| S100A9-233H | Recombinant Human S100A9 Protein, His-tagged | +Inquiry | 
| S100A9-3465B | Recombinant Bovine S100A9 protein, His-B2M & Myc-tagged | +Inquiry | 
| S100A9-12HFL | Active Recombinant Full Length Human S100A9 Protein, C-Flag-tagged | +Inquiry | 
| S100A9-3879H | Recombinant Full Length Human S100A9, None tagged | +Inquiry | 
| ◆ Native Proteins | ||
| S100A9-3179H | Native Human S100A9 protein(Met1-Pro114) | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| S100A9-684HCL | Recombinant Human S100A9 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A9 Products
Required fields are marked with *
My Review for All S100A9 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            