Recombinant Human S100A9 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : S100A9-202H
Product Overview : S100A9 MS Standard C13 and N15-labeled recombinant protein (NP_002956) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. This antimicrobial protein exhibits antifungal and antibacterial activity. [provided by RefSeq, Nov 2014]
Molecular Mass : 13.2 kDa
AA Sequence : MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name S100A9 S100 calcium binding protein A9 [ Homo sapiens (human) ]
Official Symbol S100A9
Synonyms S100A9; S100 calcium binding protein A9; CAGB, CFAG, S100 calcium binding protein A9 (calgranulin B), S100 calcium binding protein A9 (calgranulin B); protein S100-A9; 60B8AG; CGLB; LIAG; MAC387; MIF; MRP14; NIF; P14; MRP-14; calgranulin B; calgranulin-B; calprotectin L1H subunit; leukocyte L1 complex heavy chain; migration inhibitory factor-related protein 14; S100 calcium-binding protein A9 (calgranulin B); CAGB; CFAG; L1AG;
Gene ID 6280
mRNA Refseq NM_002965
Protein Refseq NP_002956
MIM 123886
UniProt ID P06702

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100A9 Products

Required fields are marked with *

My Review for All S100A9 Products

Required fields are marked with *

0
cart-icon