Recombinant Human CCL25, His-tagged
Cat.No. : | CCL25-10846H |
Product Overview : | Recombinant Human CCL25 protein(24-150aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-150aa |
Tag : | N-His |
Form : | Liquid in sterile PBS, pH7.4. |
Molecular Mass : | The protein has a calculated MW of 18 kDa. |
Endotoxin : | < 1.0EU per 1μg (determined by the LAL method). |
Purity : | > 90 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.0 mg/ml. |
Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MGSSHHHHHHHHHHSSGLVPRGSHMASMTGGQQMGRGSQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL |
Gene Name | CCL25 chemokine (C-C motif) ligand 25 [ Homo sapiens ] |
Official Symbol | CCL25 |
Synonyms | CCL25; chemokine (C-C motif) ligand 25; SCYA25, small inducible cytokine subfamily A (Cys Cys), member 25; C-C motif chemokine 25; Ck beta 15; Ckb15; TECK; TECKvar; thymus expressed chemokine; Ck beta-15; chemokine TECK; thymus-expressed chemokine; small-inducible cytokine A25; small inducible cytokine subfamily A (Cys-Cys), member 25; SCYA25; MGC150327; |
Gene ID | 6370 |
mRNA Refseq | NM_001201359 |
Protein Refseq | NP_001188288 |
MIM | 602565 |
UniProt ID | O15444 |
◆ Recombinant Proteins | ||
Ccl25-1265R | Recombinant Rat Ccl25 Protein, His-tagged | +Inquiry |
CCL25-220H | Active Recombinant Human CCL25, Met-tagged | +Inquiry |
Ccl25-69D | Recombinant Dog Ccl25 protein | +Inquiry |
Ccl25-415M | Active Recombinant Mouse Chemokine (C-C motif) Ligand 25 | +Inquiry |
Ccl25-2655M | Recombinant Mouse Ccl25 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CCL25-31214TH | Native Human CCL25 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL25-7726HCL | Recombinant Human CCL25 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL25 Products
Required fields are marked with *
My Review for All CCL25 Products
Required fields are marked with *
0
Inquiry Basket