Recombinant Human CCL25, His-tagged

Cat.No. : CCL25-10846H
Product Overview : Recombinant Human CCL25 protein(24-150aa), fused with N-terminal His tag, was expressed in E. coli.
Availability August 14, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 24-150aa
Tag : N-His
Form : Liquid in sterile PBS, pH7.4.
Molecular Mass : The protein has a calculated MW of 18 kDa.
Endotoxin : < 1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.0 mg/ml.
Reconstitution : Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MGSSHHHHHHHHHHSSGLVPRGSHMASMTGGQQMGRGSQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
Gene Name CCL25 chemokine (C-C motif) ligand 25 [ Homo sapiens ]
Official Symbol CCL25
Synonyms CCL25; chemokine (C-C motif) ligand 25; SCYA25, small inducible cytokine subfamily A (Cys Cys), member 25; C-C motif chemokine 25; Ck beta 15; Ckb15; TECK; TECKvar; thymus expressed chemokine; Ck beta-15; chemokine TECK; thymus-expressed chemokine; small-inducible cytokine A25; small inducible cytokine subfamily A (Cys-Cys), member 25; SCYA25; MGC150327;
Gene ID 6370
mRNA Refseq NM_001201359
Protein Refseq NP_001188288
MIM 602565
UniProt ID O15444

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL25 Products

Required fields are marked with *

My Review for All CCL25 Products

Required fields are marked with *

0
cart-icon