Recombinant Human CCL25, His-tagged
| Cat.No. : | CCL25-10846H |
| Product Overview : | Recombinant Human CCL25 protein(24-150aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | July 28, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 24-150aa |
| Tag : | N-His |
| Form : | Liquid in sterile PBS, pH7.4. |
| Molecular Mass : | The protein has a calculated MW of 18 kDa. |
| Endotoxin : | < 1.0EU per 1μg (determined by the LAL method). |
| Purity : | > 90 % as determined by SDS-PAGE. |
| Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.0 mg/ml. |
| Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | MGSSHHHHHHHHHHSSGLVPRGSHMASMTGGQQMGRGSQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL |
| Gene Name | CCL25 chemokine (C-C motif) ligand 25 [ Homo sapiens ] |
| Official Symbol | CCL25 |
| Synonyms | CCL25; chemokine (C-C motif) ligand 25; SCYA25, small inducible cytokine subfamily A (Cys Cys), member 25; C-C motif chemokine 25; Ck beta 15; Ckb15; TECK; TECKvar; thymus expressed chemokine; Ck beta-15; chemokine TECK; thymus-expressed chemokine; small-inducible cytokine A25; small inducible cytokine subfamily A (Cys-Cys), member 25; SCYA25; MGC150327; |
| Gene ID | 6370 |
| mRNA Refseq | NM_001201359 |
| Protein Refseq | NP_001188288 |
| MIM | 602565 |
| UniProt ID | O15444 |
| ◆ Recombinant Proteins | ||
| Ccl25-1265R | Recombinant Rat Ccl25 Protein, His-tagged | +Inquiry |
| CCL25-83H | Recombinant Human CCL25 Protein, Biotin-tagged | +Inquiry |
| CCL25-0630H | Recombinant Human CCL25 Protein, GST-Tagged | +Inquiry |
| CCL25-202H | Active Recombinant Human CCL25 protein, Fc-tagged, non-lytic | +Inquiry |
| CCL25-516R | Recombinant Rhesus Macaque CCL25 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CCL25-31214TH | Native Human CCL25 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCL25-7726HCL | Recombinant Human CCL25 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL25 Products
Required fields are marked with *
My Review for All CCL25 Products
Required fields are marked with *



