Recombinant Human CCL25 protein, GST-tagged
Cat.No. : | CCL25-2654H |
Product Overview : | Recombinant Human CCL25 protein(O15444)(24-150aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 24-150aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.2 kDa |
AA Sequence : | QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CCL25 chemokine (C-C motif) ligand 25 [ Homo sapiens ] |
Official Symbol | CCL25 |
Synonyms | CCL25; chemokine (C-C motif) ligand 25; SCYA25, small inducible cytokine subfamily A (Cys Cys), member 25; C-C motif chemokine 25; Ck beta 15; Ckb15; TECK; TECKvar; thymus expressed chemokine; Ck beta-15; chemokine TECK; thymus-expressed chemokine; small-inducible cytokine A25; small inducible cytokine subfamily A (Cys-Cys), member 25; SCYA25; MGC150327; |
Gene ID | 6370 |
mRNA Refseq | NM_001201359 |
Protein Refseq | NP_001188288 |
MIM | 602565 |
UniProt ID | O15444 |
◆ Recombinant Proteins | ||
Ccl25-625M | Recombinant Mouse Ccl25 protein | +Inquiry |
CCL25-76H | Recombinant Human CCL25 Protein | +Inquiry |
CCL25-201H | Active Recombinant Human CCL25 protein, Fc-tagged | +Inquiry |
CCL25-151H | Recombinant Human CCL25 Protein, His-tagged | +Inquiry |
Ccl25-415M | Active Recombinant Mouse Chemokine (C-C motif) Ligand 25 | +Inquiry |
◆ Native Proteins | ||
CCL25-31214TH | Native Human CCL25 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL25-7726HCL | Recombinant Human CCL25 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL25 Products
Required fields are marked with *
My Review for All CCL25 Products
Required fields are marked with *