Active Recombinant Human FCER1A Protein (26-205aa), C-His tagged

Cat.No. : FCER1A-25H
Product Overview : Recombinant human Fc epsilon RI alpha/FCER1A (26-205 aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 26-205 aa
Description : The immunoglobulin epsilon receptor (IgE receptor) is the initiator of the allergic response. When two or more high-affinity IgE receptors are brought together by allergen-bound IgE molecules, mediators such as histamine that are responsible for allergy symptoms are released. This receptor is comprised of an alpha subunit, a beta subunit, and two gamma subunits. The protein encoded by this gene represents the alpha subunit.
Form : Liquid
Bio-activity : Measured by its binding ability in a functional ELISA with Human IgE. The ED50 range ≤ 0.01 μg/mL.
Molecular Mass : 21.8 kDa (186aa)
AA Sequence : VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Notes : Note: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name FCER1A Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide [ Homo sapiens (human) ]
Official Symbol FCER1A
Synonyms FCER1A; Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide; FCE1A; high affinity immunoglobulin epsilon receptor subunit alpha; Fc-epsilon RI-alpha; Fc epsilon RI alpha-chain; igE Fc receptor subunit alpha; Fc IgE receptor, alpha polypeptide; high affinity immunoglobulin epsilon receptor alpha-subunit; immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide; FcERI
Gene ID 2205
mRNA Refseq NM_001387280
Protein Refseq NP_001374209
MIM 147140
UniProt ID P12319

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCER1A Products

Required fields are marked with *

My Review for All FCER1A Products

Required fields are marked with *

0
cart-icon