Active Recombinant Human FGF21 Protein (182 aa)
Cat.No. : | FGF21-415F |
Product Overview : | Recombinant human Fibroblast Growth Factor-21 (rhFGF-21) produced in E. coli is a single non-glycosylated polypeptide chain containing 182 amino acids. A fully biologically active molecule, rhFGF-21 has a molecular mass of 19.5 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 182 |
Description : | Fibroblast Growth Factor-21 (FGF-21) is a metabolic cytokine belonging to the heparin-binding FGF family. Along with FGF-19/15 and FGF-23, FGF-21 is categorized as a member of the atypical FGF subfamily, as it must be complexed to the Klotho co-receptor in order to bind to the FGF receptors and activate the downstream signaling pathway. In vivo FGF-21 is expressed in liver, pancreas, adipose tissue, and skeletal muscle, and it plays a central role in the energy metabolism. The expression of FGF-21 is stimulated by free fatty acids and insulin resistant states and is correlated with whole-body insulin resistance. FGF-21 activates glucose uptake in adipocytes and increases insulin sensitivity, implicating it as a novel target with potential anti-diabetic properties. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.5 μg/mL, measured by a cell proliferation assay using NIH-3T3 cells in the presence of 1.25 μg/mL mouse Klotho and 10 μg/mL heparin, corresponding to a specific activity of > 2 × 10^3 units/mg. |
Molecular Mass : | 19.5 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | GHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant human Fibroblast Growth Factor-21 (rhFGF-21) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhFGF-21 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | FGF21 fibroblast growth factor 21 [ Homo sapiens ] |
Official Symbol | FGF21 |
Synonyms | FGF21; fibroblast growth factor 21; FGF-21; |
Gene ID | 26291 |
mRNA Refseq | NM_019113 |
Protein Refseq | NP_061986 |
MIM | 609436 |
UniProt ID | Q9NSA1 |
◆ Recombinant Proteins | ||
Fgf21-110M | Recombinant Mouse Fibroblast Growth Factor 21, His-tagged | +Inquiry |
Fgf21-109M | Recombinant Mouse Fibroblast Growth Factor 21 | +Inquiry |
Fgf21-257M | Active Recombinant Mouse Fgf21 Protein (Ala29-Ser210), N-His tagged, Animal-free, Carrier-free | +Inquiry |
Fgf21-258M | Recombinant Mouse Fgf21, Fc-tagged | +Inquiry |
FGF21-28829TH | Recombinant Human FGF21, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF21-1890MCL | Recombinant Mouse FGF21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF21 Products
Required fields are marked with *
My Review for All FGF21 Products
Required fields are marked with *
0
Inquiry Basket