| Species : |
Human |
| Source : |
E.coli |
| Protein Length : |
182 |
| Description : |
Fibroblast Growth Factor-21 (FGF-21) is a metabolic cytokine belonging to the heparin-binding FGF family. Along with FGF-19/15 and FGF-23, FGF-21 is categorized as a member of the atypical FGF subfamily, as it must be complexed to the Klotho co-receptor in order to bind to the FGF receptors and activate the downstream signaling pathway. In vivo FGF-21 is expressed in liver, pancreas, adipose tissue, and skeletal muscle, and it plays a central role in the energy metabolism. The expression of FGF-21 is stimulated by free fatty acids and insulin resistant states and is correlated with whole-body insulin resistance. FGF-21 activates glucose uptake in adipocytes and increases insulin sensitivity, implicating it as a novel target with potential anti-diabetic properties. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
ED50 < 0.5 μg/mL, measured by a cell proliferation assay using NIH-3T3 cells in the presence of 1.25 μg/mL mouse Klotho and 10 μg/mL heparin, corresponding to a specific activity of > 2 × 10^3 units/mg. |
| Molecular Mass : |
19.5 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : |
GHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS |
| Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
| Purity : |
> 95% as analyzed by SDS-PAGE and HPLC. |
| Storage : |
Lyophilized recombinant human Fibroblast Growth Factor-21 (rhFGF-21) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhFGF-21 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
| Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
| Reconstitution : |
Reconstituted in ddH2O at 100 μg/mL. |