| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
181 |
| Description : |
Fibroblast growth factor-21 (FGF-21) belongs to the large FGF family which is encoded by the FGF-21 gene and it is specifically induced by HMGCS2 activity. All FGF family members are heparin binding growth factors with a core 120 amino acid (a.a.) FGF domain that allows for a common tertiary structure and they are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF-21 stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression) and the activity depends on the presence of KLB. FGF-21 contains a 28 a.a. signal sequence and a 181 a.a. mature region but show limited binding to heparin. In addition, Mature human FGF-21 respectively shows 81 % a.a. identity to murine and rat FGF-21, and is known to be active on murine cells. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/ml, corresponding to a specific activity of > 2.0 × 10³ IU/mg in the presence of 5 µg/ml of rMuKlotho-β and 10 μg/ml of heparin. |
| Molecular Mass : |
Approximately 19.4 kDa, a single non-glycosylated polypeptide chain containing 181 amino acids. |
| AA Sequence : |
HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS |
| Endotoxin : |
Less than 1 EU/µg of rHuFGF-21 as determined by LAL method. |
| Purity : |
>96% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
