Recombinant Human FGF21 protein

Cat.No. : FGF21-562H
Product Overview : Recombinant Human FGF21 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 181
Description : Fibroblast growth factor-21 (FGF-21) belongs to the large FGF family which is encoded by the FGF-21 gene and it is specifically induced by HMGCS2 activity. All FGF family members are heparin binding growth factors with a core 120 amino acid (a.a.) FGF domain that allows for a common tertiary structure and they are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF-21 stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression) and the activity depends on the presence of KLB. FGF-21 contains a 28 a.a. signal sequence and a 181 a.a. mature region but show limited binding to heparin. In addition, Mature human FGF-21 respectively shows 81 % a.a. identity to murine and rat FGF-21, and is known to be active on murine cells.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/ml, corresponding to a specific activity of > 2.0 × 10³ IU/mg in the presence of 5 µg/ml of rMuKlotho-β and 10 μg/ml of heparin.
Molecular Mass : Approximately 19.4 kDa, a single non-glycosylated polypeptide chain containing 181 amino acids.
AA Sequence : HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Endotoxin : Less than 1 EU/µg of rHuFGF-21 as determined by LAL method.
Purity : >96% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name FGF21
Official Symbol FGF21
Synonyms FGF21; fibroblast growth factor 21; FGF-21;
Gene ID 26291
mRNA Refseq NM_019113
Protein Refseq NP_061986
MIM 609436
UniProt ID Q9NSA1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF21 Products

Required fields are marked with *

My Review for All FGF21 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon