Recombinant Mouse IL1B protein, GST-tagged
Cat.No. : | IL1B-1416M |
Product Overview : | Recombinant Mouse IL1B protein(118-269 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Tag : | GST |
Protein Length : | 118-269 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS |
Gene Name | Il1b interleukin 1 beta [ Mus musculus ] |
Official Symbol | IL1B |
Synonyms | IL1B; interleukin 1 beta; interleukin-1 beta; IL-1 beta; Il-1b; IL-1beta; |
Gene ID | 16176 |
mRNA Refseq | NM_008361 |
Protein Refseq | NP_032387 |
◆ Recombinant Proteins | ||
IL1B-3698H | Recombinant Human IL1B protein, Trx-His-SUMO-tagged | +Inquiry |
Il1b-603M | Active Recombinant Mouse Il1b | +Inquiry |
IL1B-1602H | Active Recombinant Human IL1B protein, His-Avi-tagged, Biotinylated | +Inquiry |
IL1B-461H | Active Recombinant Human Interleukin 1, Beta | +Inquiry |
IL1B-460H | Recombinant Human IL1B protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1B Products
Required fields are marked with *
My Review for All IL1B Products
Required fields are marked with *