Active Recombinant Human IL33 Protein

Cat.No. : IL33-174H
Product Overview : Recombinant Human IL33 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Interleukin 33 (IL-33) is a member of the IL-1 cytokine family and is constitutively expressed in smooth muscle and airway epithelial cells. IL-33 signals through the interleukin 1 receptor-like 1 (IL-1R1) and interleukin-1 receptor accessory protein (IL1RAP) receptors to ativate NF-κB and MAPK signaling pathways. IL-33 functions to induce type 2 cytokine production in polarized Type 2 helper T (Th2) cells.
Bio-activity : D10S cell proliferation, ≤500 pg/mL; ≥2.0 x 10^6 units/mg
Molecular Mass : Monomer, 18.1 kDa (160 aa)
AA Sequence : MSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name IL33 interleukin 33 [ Homo sapiens (human) ]
Official Symbol IL33
Synonyms IL33; interleukin 33; C9orf26, chromosome 9 open reading frame 26 (NF HEV); interleukin-33; DKFZp586H0523; DVS27; DVS27 related protein; IL1F11; interleukin 1 family; member 11; NF HEV; nuclear factor for high endothelial venules; IL-33; IL-1F11; DVS27-related protein; interleukin-1 family member 11; nuclear factor from high endothelial venules; NF-HEV; NFEHEV; C9orf26; RP11-575C20.2;
Gene ID 90865
mRNA Refseq NM_001199640
Protein Refseq NP_001186569
MIM 608678
UniProt ID O95760

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL33 Products

Required fields are marked with *

My Review for All IL33 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon