Active Recombinant Mouse Il33 Protein, His-Tagged

Cat.No. : Il33-01M
Product Overview : Recombinant mouse Il33 Protein, His-tagged was expressed in E. coli cell
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Interleukin 33 (IL-33) is a member of the IL-1 family that potently drives production of T helper-2 (Th2)-associated cytokines (e.g., IL-4). IL33 is a ligand for ST2 (IL1RL1), an IL-1 family receptor that is highly expressed on Th2 cells, mast cells and group 2 innate lymphocytes. It is expressed by a wide variety of cell types, including fibroblasts, mast cells, dendritic cells, macrophages, osteoblasts, endothelial cells, and epithelial cells.
Form : Lyophilized powder
AA Sequence : MSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHAND
KDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Bio-activity : Measure by its ability to induce proliferation in D10.G4.1 cells. The ED50 for this effect is <40 pg/mL. The specific activity of recombinant mouse IL-33 is > 2 x 10^7 IU/mg.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Notes : Please use within one month after protein reconstitution.
Gene Name Il33 interleukin 33 [ Mus musculus (house mouse) ]
Official Symbol Il33
Synonyms Il-33; Il1f11; NF-HEV; 9230117N10Rik
Gene ID 77125
mRNA Refseq NM_001164724.2
Protein Refseq NP_001158196.1
UniProt ID Q8BVZ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il33 Products

Required fields are marked with *

My Review for All Il33 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon