Active Recombinant Mouse Flt3l Protein, His-tagged
Cat.No. : | Flt3l-02M |
Product Overview : | Recombinant Mouse Flt3l Protein with His tag was expressed in Chinese Hamster Ovary cell line. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | CHO |
Tag : | His |
Description : | Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. |
Bio-activity : | ED50 < 10 ng /mL, measured in a cell proliferation assay using AML5 cells. |
Molecular Mass : | 24-30 kDa |
AA Sequence : | GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRHHHHHH |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE |
Storage : | Up to 6 months at lower than -70 centigrade from date of receipt. Upon reconstitution, Stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Flt3l FMS-like tyrosine kinase 3 ligand [ Mus musculus (house mouse) ] |
Official Symbol | Flt3l |
Synonyms | Flt3l; FMS-like tyrosine kinase 3 ligand; Ly72L; Flt3lg; fms-related tyrosine kinase 3 ligand; flt3 ligand |
Gene ID | 14256 |
mRNA Refseq | NM_013520 |
Protein Refseq | NP_038548 |
UniProt ID | P49772 |
◆ Recombinant Proteins | ||
Flt3l-63M | Recombinant Mouse Flt3l protein, His-tagged | +Inquiry |
Flt3l-8704M | Recombinant Mouse Flt3l, Fc tagged | +Inquiry |
Flt3l-26M | Active Recombinant Mouse Flt3l Protein (Gly27-Arg188), C-His tagged, Animal-free, Carrier-free | +Inquiry |
Flt3l-3046M | Recombinant Mouse Flt3l Protein, Myc/DDK-tagged | +Inquiry |
Flt3l-03M | Active Recombinant Mouse Flt3l | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLT3LG-1387MCL | Recombinant Mouse FLT3LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Flt3l Products
Required fields are marked with *
My Review for All Flt3l Products
Required fields are marked with *