Active Recombinant Mouse Flt3l Protein, His-tagged

Cat.No. : Flt3l-02M
Product Overview : Recombinant Mouse Flt3l Protein with His tag was expressed in Chinese Hamster Ovary cell line.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : CHO
Tag : His
Description : Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
Bio-activity : ED50 < 10 ng /mL, measured in a cell proliferation assay using AML5 cells.
Molecular Mass : 24-30 kDa
AA Sequence : GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRHHHHHH
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE
Storage : Up to 6 months at lower than -70 centigrade from date of receipt.
Upon reconstitution, Stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Flt3l FMS-like tyrosine kinase 3 ligand [ Mus musculus (house mouse) ]
Official Symbol Flt3l
Synonyms Flt3l; FMS-like tyrosine kinase 3 ligand; Ly72L; Flt3lg; fms-related tyrosine kinase 3 ligand; flt3 ligand
Gene ID 14256
mRNA Refseq NM_013520
Protein Refseq NP_038548
UniProt ID P49772

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Flt3l Products

Required fields are marked with *

My Review for All Flt3l Products

Required fields are marked with *

0
cart-icon
0
compare icon