Active Recombinant Mouse Flt3l Protein, His-tagged

• Cat.No.: Flt3l-02M
• Product Overview: Recombinant Mouse Flt3l Protein with His tag was expressed in Chinese Hamster Ovary cell line.

Specification

• Species: Mouse
• Source: CHO
• Tag: His
• Description: Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
• Bio-activity: ED50 < 10 ng /mL, measured in a cell proliferation assay using AML5 cells.
• Molecular Mass: 24-30 kDa
• AA Sequence: GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRHHHHHH
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE
• Storage: Up to 6 months at lower than -70 centigrade from date of receipt.
  Upon reconstitution, Stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Flt3l FMS-like tyrosine kinase 3 ligand [ Mus musculus (house mouse) ]
• Official Symbol: Flt3l
• Synonyms: Flt3l; FMS-like tyrosine kinase 3 ligand; Ly72L; Flt3lg; fms-related tyrosine kinase 3 ligand; flt3 ligand
• Gene ID: 14256
• mRNA Refseq: NM_013520
• Protein Refseq: NP_038548
• UniProt ID: P49772