"Flt3l" Related Products

Expand
Expand

Recombinant Mouse Flt3l protein, His-tagged

Cat.No.: Flt3l-457M
Product Overview: Recombinant Mouse Flt3l(Gly27-Arg188) fused with His tag at C-terminal was expressed in HEK293.
Source: HEK293
Species: Mouse
Tag: His
Form: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 .
Protein length: Gly27-Arg188
AA Sequence: GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVA GSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRC LEVQCQPDSSTLLPPRSPIALEATELPEPRPRVDHHHHHH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping: The product is shipped at ambient temperature.
Gene Name: Flt3l FMS-like tyrosine kinase 3 ligand [ Mus musculus ]
Official Symbol: Flt3l
Synonyms: Ly72L; Flt3lg; flt3 ligand
Gene ID: 14256
mRNA Refseq: NM_013520
Protein Refseq: NP_038548
MIM:
UniProt ID: P49772
Chromosome Location: 7 29.14 cM; 7 B2-C
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem
Function: cytokine activity; protein homodimerization activity; receptor tyrosine kinase binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.