"Flt3l" Related Products

Expand
Expand

Recombinant Mouse Flt3l protein, His-tagged

Cat.No.: Flt3l-457M
Product Overview: Recombinant Mouse Flt3l(Gly27-Arg188) fused with His tag at C-terminal was expressed in HEK293.
Source: HEK293
Species: Mouse
Tag: His
Form: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 .
Protein length: Gly27-Arg188
AA Sequence: GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVA GSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRC LEVQCQPDSSTLLPPRSPIALEATELPEPRPRVDHHHHHH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping: The product is shipped at ambient temperature.
Gene Name: Flt3l FMS-like tyrosine kinase 3 ligand [ Mus musculus ]
Official Symbol: Flt3l
Synonyms: Ly72L; Flt3lg; flt3 ligand
Gene ID: 14256
mRNA Refseq: NM_013520
Protein Refseq: NP_038548
MIM:
UniProt ID: P49772
Chromosome Location: 7 29.14 cM; 7 B2-C
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem
Function: cytokine activity; protein homodimerization activity; receptor tyrosine kinase binding

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.