"Flt3l" Related Products

Expand
Expand

Recombinant Mouse Flt3l protein, His-tagged

Cat.No. : Flt3l-457M
Product Overview : Recombinant Mouse Flt3l(Gly27-Arg188) fused with His tag at C-terminal was expressed in HEK293.
Source : HEK293
Species : Mouse
Tag : His
Form : Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 .
Protein length : Gly27-Arg188
AA Sequence : GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVA GSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRC LEVQCQPDSSTLLPPRSPIALEATELPEPRPRVDHHHHHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping : The product is shipped at ambient temperature.
Gene Name : Flt3l FMS-like tyrosine kinase 3 ligand [ Mus musculus ]
Official Symbol : Flt3l
Synonyms : Ly72L; Flt3lg; flt3 ligand
Gene ID : 14256
mRNA Refseq : NM_013520
Protein Refseq : NP_038548
MIM :
UniProt ID : P49772
Chromosome Location : 7 29.14 cM; 7 B2-C
Pathway : Cytokine-cytokine receptor interaction, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem
Function : cytokine activity; protein homodimerization activity; receptor tyrosine kinase binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.