Active Recombinant Mouse Il21 Protein

Cat.No. : Il21-10M
Product Overview : Recombinant mouse IL-21 (18-146aa) without tag was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 18-146 a.a.
Description : Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG1 and IgG3 in B-cells
Form : Liquid
Bio-activity : The activity is determined by the IFN-g ELISA in a using NK-92 human natural killer cells. The ED50 range ≤ 100 ng/mL.
Molecular Mass : 15 kDa confirmed by MALDI-TOF
Identity : 130aa
AA Sequence : MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by Bradford assay)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4)
Gene Name Il21 interleukin 21 [ Mus musculus (house mouse) ]
Official Symbol Il21
Synonyms Il21; interleukin 21; IL-21; interleukin-21
Gene ID 60505
mRNA Refseq NM_021782
Protein Refseq NP_068554
UniProt ID Q9ES17

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il21 Products

Required fields are marked with *

My Review for All Il21 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon