Active Recombinant Mouse Il21 Protein
Cat.No. : | Il21-10M |
Product Overview : | Recombinant mouse IL-21 (18-146aa) without tag was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 18-146 a.a. |
Description : | Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG1 and IgG3 in B-cells |
Form : | Liquid |
Bio-activity : | The activity is determined by the IFN-g ELISA in a using NK-92 human natural killer cells. The ED50 range ≤ 100 ng/mL. |
Molecular Mass : | 15 kDa confirmed by MALDI-TOF |
Identity : | 130aa |
AA Sequence : | MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Storage : | Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/mL (determined by Bradford assay) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) |
Gene Name | Il21 interleukin 21 [ Mus musculus (house mouse) ] |
Official Symbol | Il21 |
Synonyms | Il21; interleukin 21; IL-21; interleukin-21 |
Gene ID | 60505 |
mRNA Refseq | NM_021782 |
Protein Refseq | NP_068554 |
UniProt ID | Q9ES17 |
◆ Recombinant Proteins | ||
Il21-10M | Active Recombinant Mouse Il21 Protein | +Inquiry |
IL21-2205C | Recombinant Chicken IL21 | +Inquiry |
IL21-630C | Active Recombinant Canine IL21 protein | +Inquiry |
IL21-1298C | Active Recombinant Cynomolgus IL21 protein, His-tagged | +Inquiry |
IL21-6949Z | Recombinant Zebrafish IL21 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL21-001RCL | Recombinant Rat IL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il21 Products
Required fields are marked with *
My Review for All Il21 Products
Required fields are marked with *
0
Inquiry Basket