Active Recombinant Mouse Il33 Protein
Cat.No. : | Il33-5186M |
Product Overview : | Mouse Il33 (Q8BVZ5, 109 a.a. - 266 a.a.) partial recombinant protein expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 109-266 a.a. |
Description : | Interleukin 33 (IL-33) is a protein that in humans is encoded by the IL33 gene. Interleukin 33 is a member of the IL-1 family that potently drives production of T helper-2 (Th2)-associated cytokines (e.g., IL-4). IL33 is a ligand for ST2 (IL1RL1), an IL-1 family receptor that is highly expressed on Th2 cells, mast cells and group 2 innate lymphocytes. IL-33 is expressed by a wide variety of cell types, including fibroblasts, mast cells, dendritic cells, macrophages, osteoblasts, endothelial cells, and epithelial cells. |
Form : | Lyophilized |
Bio-activity : | The ED50 was determined by the dose-dependent proliferation of murine D10S cells is ≤ 0.3 ng/mL. |
Molecular Mass : | 18 kDa |
AA Sequence : | SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI |
Endotoxin : | Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be less than 0.1 ng/μg (1EU/μg). |
Purity : | > 90% by SDS-PAGE and HPLC |
Applications : | Functional Study SDS-PAGE |
Storage : | Store at -20 centigrade on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4 centigrade for 1 month or store at -20 centigrade for 6 months. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | Lyophilized from PBS, pH 7.5 |
Gene Name | Il33 interleukin 33 [ Mus musculus ] |
Official Symbol | Il33 |
Synonyms | IL33; interleukin 33; interleukin-33; nuclear factor from high endothelial venules; Il-33; Il1f11; NF-HEV; 9230117N10Rik; |
Gene ID | 77125 |
mRNA Refseq | NM_001164724 |
Protein Refseq | NP_001158196 |
◆ Recombinant Proteins | ||
IL33-1019M | Recombinant Mouse IL33 protein, His-tagged | +Inquiry |
Il33-358M | Active Recombinant Mouse Il33, His-tagged | +Inquiry |
Il33-157M | Recombinant Mouse Il33 Protein | +Inquiry |
IL33-486H | Active Recombinant Human IL33 Protein | +Inquiry |
Il33-5186M | Active Recombinant Mouse Il33 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL33-5226HCL | Recombinant Human IL33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il33 Products
Required fields are marked with *
My Review for All Il33 Products
Required fields are marked with *
0
Inquiry Basket