Recombinant Dog IL33 protein(102-263aa), His-tagged
Cat.No. : | IL33-643D |
Product Overview : | Recombinant Dog IL33 protein(O97863)(102-263aa), fused with N-terminal His tag, was expressed in Insect Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 102-263aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.0 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | CFGRANVPSIQEYSASLSTYNDQSITFVFEDGSYEIYVEDLRKGQEKDKVLFRYYDSQSPSHETGDDVDGQTLLVNLSPTKDKDFLLHANNEEHSVELQKCENQLPDQAFFLLHRKSSECVSFECKNNPGVFIGVKDNHLALIKVGDQTKDSYIEKTIFKLS |
Gene Name | IL33 interleukin 33 [ Canis lupus familiaris ] |
Official Symbol | IL33 |
Synonyms | IL33; interleukin 33; interleukin-33; IL-33; DVS27; |
Gene ID | 403810 |
mRNA Refseq | NM_001003180 |
Protein Refseq | NP_001003180 |
◆ Recombinant Proteins | ||
Il33-157M | Recombinant Mouse Il33 Protein | +Inquiry |
Il33-3521M | Recombinant Mouse Il33 Protein | +Inquiry |
IL33-643D | Recombinant Dog IL33 protein(102-263aa), His-tagged | +Inquiry |
Il33-158M | Active Recombinant Mouse Il33 Protein | +Inquiry |
IL33-1917M | Recombinant Mouse IL33 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL33-5226HCL | Recombinant Human IL33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL33 Products
Required fields are marked with *
My Review for All IL33 Products
Required fields are marked with *