Expand
Expand
| Cat.No.: | IL13-4328HG |
| Product Overview: | Recombinant Human IL12A was produced in E. coli using non-animal reagents in an animal-free facility under cGMP guidelines. |
| Description: | Human Interleukin-13 (IL-13) is expressed by the IL13 gene located on the chromosome 5 and secreted by many cell types, especially T helper type 2 (Th2) cells. The high solution from of IL-13 reported to be a monomer with two internal disulfide bonds that contribute to a bundled four α-helix configuration. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1beta, TNF-alpha, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching resulting in increased production of IgE. Human, mouse and rat IL-3 share low homology, but have cross species activity. |
| Source: | E. coli |
| Species: | Human |
| Form: | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4 with 5 % trehalose. |
| Bio-activity: | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 1 ng/ml, corresponding to a specific activity of > 1.0 × 10^6 IU/mg. |
| Molecular Mass: | Approximately 12.5 kDa, a single non-glycosylated polypeptide chain containing 112 amino acids. |
| AA Sequence: | GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN |
| Endotoxin: | Less than 1 EU/µg of rHuIL-13 as determined by LAL method. |
| Purity: | > 97 % by SDS-PAGE and HPLC analyses. |
| Storage: | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw cycles. |
| Reconstitution: | Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| Quality Statement: | Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing. |
| Shipping: | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
| Gene Name: | IL13 interleukin 13 [ Homo sapiens ] |
| Official Symbol: | IL13 |
| Synonyms: | IL13; interleukin 13; interleukin-13; allergic rhinitis; ALRH; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; MGC116786; MGC116788; MGC116789; P600; Bronchial hyperresponsiveness-1 (bronchial asthma); IL-13; |
| Gene ID: | 3596 |
| mRNA Refseq: | NM_002188 |
| Protein Refseq: | NP_002179 |
| MIM: | 147683 |
| UniProt ID: | P35225 |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All IL13 Products
Download Datasheet