Recombinant Active Human FGF21 Protein, His-tagged(C-ter)

Cat.No. : FGF21-81H
Product Overview : Recombinant Active Human FGF21 Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined. [provided by RefSeq, Jul 2008]
Form : Powder
Bio-activity : Determined by its ability to induce proliferation in BaF3 mouse pro-B cells transfected with human FGFRIIIc. The ED50 for this effect is < 0.4 μg/mL.
AA Sequence : MHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 98% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 8.0)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name FGF21 fibroblast growth factor 21 [ Homo sapiens ]
Official Symbol FGF21
Synonyms FGF21; fibroblast growth factor 21; FGF-21;
Gene ID 26291
mRNA Refseq NM_019113
Protein Refseq NP_061986
MIM 609436
UniProt ID Q9NSA1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF21 Products

Required fields are marked with *

My Review for All FGF21 Products

Required fields are marked with *

0
cart-icon