Recombinant Mouse Fgf21 protein

Cat.No. : Fgf21-563M
Product Overview : Recombinant Mouse Fgf21 protein was expressed in Escherichia coli.
Availability September 12, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 182
Description : Fibroblast growth factor-21 (FGF-21) belongs to the large FGF family and it is specifically induced by HMGCS2 activity. In mice, brown adipose tissue becomes a source of systemic FGF21 after cold exposure. FGF-21 stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression) and the activity depends on the presence of KLB. FGF-21, in the presence of betaKlotho as a protein cofactor, signals through the FGFR 1c and 4 receptors. Recombinant murine FGF-21 contains 182 amino acids residues and show limited binding to heparin. In addition, Murine FGF-21 respectively shows 81 % and 92 % a.a. identity to human and rat FGF-21, and it show activity on human and rat cells.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 3 × PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/ml, corresponding to a specific activity of > 2.0 × 10³ IU/mg in the presence of 5 µg/ml of rMuKlotho-β and 10 μg/ml of heparin.
Molecular Mass : Approximately 19.9 kDa, a single non-glycosylated polypeptide chain containing 182 amino acids.
AA Sequence : AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
Endotoxin : Less than 1 EU/µg of rMuFGF-21 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Publications :
Alcoholic fatty liver is enhanced in CYP2A5 knockout mice: The role of the PPARα-FGF21 axis. (2017)
Deficiency of fibroblast growth factor 21 aggravates obesity-induced atrophic responses in skeletal muscle (2019)
Gene Name Fgf21
Official Symbol Fgf21
Synonyms FGF21; fibroblast growth factor 21; FGF-21;
Gene ID 56636
mRNA Refseq NM_020013
Protein Refseq NP_064397
UniProt ID Q9JJN1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Fgf21 Products

Required fields are marked with *

My Review for All Fgf21 Products

Required fields are marked with *

0
cart-icon