Recombinant Mouse Fgf21 protein
Cat.No. : | Fgf21-563M |
Product Overview : | Recombinant Mouse Fgf21 protein was expressed in Escherichia coli. |
Availability | June 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 182 |
Description : | Fibroblast growth factor-21 (FGF-21) belongs to the large FGF family and it is specifically induced by HMGCS2 activity. In mice, brown adipose tissue becomes a source of systemic FGF21 after cold exposure. FGF-21 stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression) and the activity depends on the presence of KLB. FGF-21, in the presence of betaKlotho as a protein cofactor, signals through the FGFR 1c and 4 receptors. Recombinant murine FGF-21 contains 182 amino acids residues and show limited binding to heparin. In addition, Murine FGF-21 respectively shows 81 % and 92 % a.a. identity to human and rat FGF-21, and it show activity on human and rat cells. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 3 × PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/ml, corresponding to a specific activity of > 2.0 × 10³ IU/mg in the presence of 5 µg/ml of rMuKlotho-β and 10 μg/ml of heparin. |
Molecular Mass : | Approximately 19.9 kDa, a single non-glycosylated polypeptide chain containing 182 amino acids. |
AA Sequence : | AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS |
Endotoxin : | Less than 1 EU/µg of rMuFGF-21 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Publications : |
Alcoholic fatty liver is enhanced in CYP2A5 knockout mice: The role of the PPARα-FGF21 axis. (2017)
Deficiency of fibroblast growth factor 21 aggravates obesity-induced atrophic responses in skeletal muscle (2019)
|
Gene Name | Fgf21 |
Official Symbol | Fgf21 |
Synonyms | FGF21; fibroblast growth factor 21; FGF-21; |
Gene ID | 56636 |
mRNA Refseq | NM_020013 |
Protein Refseq | NP_064397 |
UniProt ID | Q9JJN1 |
◆ Recombinant Proteins | ||
FGF21-1966H | Recombinant Human FGF21 Protein, MYC/DDK-tagged | +Inquiry |
Fgf21-5453M | Recombinant Mouse Fgf21 Protein (Ala29-Ser210), N-His tagged | +Inquiry |
Fgf21-7399M | Recombinant Mouse Fgf21 Protein, His-tagged | +Inquiry |
FGF21-2596H | Recombinant Human FGF21 protein | +Inquiry |
FGF21-930H | Recombinant Human FGF21 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF21-1890MCL | Recombinant Mouse FGF21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fgf21 Products
Required fields are marked with *
My Review for All Fgf21 Products
Required fields are marked with *