Recombinant Active Mouse IL17A Protein, His-tagged(C-ter)
Cat.No. : | Il17a-149M |
Product Overview : | Recombinant Active Mouse IL17A Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is < 1 ng/mL. The specific activity of recombinant mouse IL-17A is > 1 x 10^6 IU/mg. |
AA Sequence : | MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | 20 mM Sodium citrate (pH 4.5) and 0.2 M NaCl. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | Il17a interleukin 17A [ Mus musculus ] |
Official Symbol | Il17a |
Synonyms | IL17A; interleukin 17A; interleukin-17A; cytotoxic T-lymphocyte-associated antigen 8; Il17; Ctla8; IL-17; Ctla-8; IL-17A; |
Gene ID | 16171 |
mRNA Refseq | NM_010552 |
Protein Refseq | NP_034682 |
◆ Recombinant Proteins | ||
IL17A-153M | Recombinant Marmoset IL17A | +Inquiry |
IL17A-1235H | Active Recombinant Human IL17A protein, His-tagged | +Inquiry |
Il17a-334M | Recombinant Mouse Il17a, His-tagged | +Inquiry |
IL17A-98O | Recombinant Ovine IL-17A | +Inquiry |
IL17A-441R | Active Recombinant Rabbit IL17 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL17A Products
Required fields are marked with *
My Review for All IL17A Products
Required fields are marked with *
0
Inquiry Basket