Recombinant Rabbit IL17A protein, GST-tagged
| Cat.No. : | IL17A-3093R |
| Product Overview : | Recombinant Rabbit IL17A protein(G1SLF2)(21-153aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rabbit |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 21-153aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 42.3 kDa |
| AA Sequence : | VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| IL17A-15P | Recombinant Pig IL17A Protein (Gly26-Ser155), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| IL17A-508M | Recombinant Mouse IL17A Protein | +Inquiry |
| Il17a-094M | Active Recombinant Mouse Il17a Protein | +Inquiry |
| IL17A-254E | Recombinant Equine Interleukin 17A | +Inquiry |
| IL17A-116H | Recombinant Human IL17A Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| IL17A-048H | Active Glycosylated Recombinant Human IL17A Homodimer | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL17A Products
Required fields are marked with *
My Review for All IL17A Products
Required fields are marked with *
