Recombinant Rabbit IL17A protein, GST-tagged
Cat.No. : | IL17A-3093R |
Product Overview : | Recombinant Rabbit IL17A protein(G1SLF2)(21-153aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | E.coli |
Tag : | GST |
Protein Length : | 21-153aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.3 kDa |
AA Sequence : | VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
IL17A-1588C | Active Recombinant Canine IL17A protein, His-tagged | +Inquiry |
IL17A-440R | Active Recombinant Rabbit IL17 Protein, His-tagged | +Inquiry |
IL17A-572H | Active Recombinant Human Interleukin 17A, HIgG1 Fc-tagged | +Inquiry |
IL17A-98O | Recombinant Ovine IL-17A | +Inquiry |
IL17A-903HFL | Recombinant Full Length Human IL17A Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL17A Products
Required fields are marked with *
My Review for All IL17A Products
Required fields are marked with *
0
Inquiry Basket