Recombinant Rhesus macaque IL17A protein, GST-tagged
| Cat.No. : | IL17A-3092R |
| Product Overview : | Recombinant Rhesus macaque IL17A protein(F6T3G5)(24-155aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rhesus macaque |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 24-155aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 42.1 kDa |
| AA Sequence : | GIAIPRNPGCPNSEDKTFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNADGNVDYHMNSVPIQQEILVLRREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| IL17A-572H | Active Recombinant Human Interleukin 17A, HIgG1 Fc-tagged | +Inquiry |
| IL17A-1235H | Active Recombinant Human IL17A protein, His-tagged | +Inquiry |
| IL17A-868D | Recombinant Dog IL17A protein, His & T7-tagged | +Inquiry |
| IL17A-5438R | Recombinant Rabbit IL17A protein, His-tagged | +Inquiry |
| IL17A-122H | Recombinant Human IL17A protein | +Inquiry |
| ◆ Native Proteins | ||
| IL17A-048H | Active Glycosylated Recombinant Human IL17A Homodimer | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL17A Products
Required fields are marked with *
My Review for All IL17A Products
Required fields are marked with *
