Recombinant human Activin B

Cat.No. : INHBB-1545H
Product Overview : Recombinant human Activin B is a βB subunit single chain containing 123 amino residues and a molecular weight of 14 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Nicotiana Benthamiana
Tag : Non
Description : Activins are homodimers or heterodimers of the various β subunit isoforms, belonging to the TGF-beta family. Mature Activin B has two chains of 123 amino acids residues (betaB-betaB). Activin exhibits a wide range of biological activities, including mesoderm induction, neural cell differentiation, bone remodelling, haematopoiesis, and reproductive physiology. Activins plays a key role in the production and regulation of hormones such as FSH, LH, GnRH and ACTH. Inhibins/Activins are protein that are formed by the dimerization of two subunits, i. e. an α (alpha) with either beta A (βA) - Inhibin A or beta B (βB) - Inhibin B. The subunits betaA and betaB can also form homodimers or heterodimers called Activin: Activin A (betaA -betaA), Activin B (betaB -betaB) and Activin AB (betaA -betaB). The Activin gene family comprises the additional, but poorly characterized members" Activin betaC (βC), beta D (βD) and beta E (βE). As with other members of the super-family, Activins interact with two types of cell surface trans-membrane receptors (Types I and II) which have intrinsic serine/threonine kinase activities in their cytoplasmic domains, Activin type 1 receptors, ACVR1, ACVR1B, ACVR1C and Activin type 2 receptors, ACVR2A, ACVR2B.
Form : Recombinant human Activin B is lyophilized from Tris HCl 0.05M buffer at pH 7.4.
Molecular Mass : 14 kDa
AA Sequence : HHHHHHHHHHGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQ YRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
Endotoxin : < 0.04="" eu/μg="" protein="" (lal="">
Purity : >97% by SDS-PAGE gel
Storage : This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended.
Reconstitution : Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 50 ng/μl. When reconstituting the product, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. At higher concentration the solubility may be reduced and multimers generated. Optimal concentration should be determined for specific application and cell lines.
Gene Name INHBB inhibin, beta B [ Homo sapiens ]
Official Symbol INHBB
Synonyms INHBB; inhibin, beta B; inhibin, beta B (activin AB beta polypeptide); inhibin beta B chain; Inhibin, beta-2; activin beta-B chain; activin AB beta polypeptide; MGC157939;
Gene ID 3625
mRNA Refseq NM_002193
Protein Refseq NP_002184
MIM 147390
UniProt ID P09529
Chromosome Location 2cen-q13
Pathway Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Glycoprotein hormones, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Peptide hormone biosynthesis, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem;
Function cytokine activity; growth factor activity; hormone activity; host cell surface receptor binding; protein binding; protein homodimerization activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INHBB Products

Required fields are marked with *

My Review for All INHBB Products

Required fields are marked with *

0
cart-icon