Recombinant Human AKR1C3 Protein, GST-tagged

Cat.No. : AKR1C3-413H
Product Overview : Human AKR1C3 full-length ORF ( AAH01479, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]
Molecular Mass : 61.16 kDa
AA Sequence : MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AKR1C3 aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) [ Homo sapiens ]
Official Symbol AKR1C3
Synonyms AKR1C3; aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II); HSD17B5, hydroxysteroid (17 beta) dehydrogenase 5; aldo-keto reductase family 1 member C3; DDX; dihydrodiol dehydrogenase X; HAKRB; KIAA0119; PGFS; prostaglandin F synthase; indanol dehydrogenase; 3-alpha-HSD type II, brain; dihydrodiol dehydrogenase 3; chlordecone reductase homolog HAKRb; testosterone 17-beta-dehydrogenase 5; type IIb 3-alpha hydroxysteroid dehydrogenase; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; DD3; HAKRe; HA1753; HSD17B5; hluPGFS;
Gene ID 8644
mRNA Refseq NM_001253909
Protein Refseq NP_001240838
MIM 603966
UniProt ID P42330

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AKR1C3 Products

Required fields are marked with *

My Review for All AKR1C3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon