Recombinant Human AKR1C3 Protein, GST-tagged
Cat.No. : | AKR1C3-413H |
Product Overview : | Human AKR1C3 full-length ORF ( AAH01479, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011] |
Molecular Mass : | 61.16 kDa |
AA Sequence : | MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AKR1C3 aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) [ Homo sapiens ] |
Official Symbol | AKR1C3 |
Synonyms | AKR1C3; aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II); HSD17B5, hydroxysteroid (17 beta) dehydrogenase 5; aldo-keto reductase family 1 member C3; DDX; dihydrodiol dehydrogenase X; HAKRB; KIAA0119; PGFS; prostaglandin F synthase; indanol dehydrogenase; 3-alpha-HSD type II, brain; dihydrodiol dehydrogenase 3; chlordecone reductase homolog HAKRb; testosterone 17-beta-dehydrogenase 5; type IIb 3-alpha hydroxysteroid dehydrogenase; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; DD3; HAKRe; HA1753; HSD17B5; hluPGFS; |
Gene ID | 8644 |
mRNA Refseq | NM_001253909 |
Protein Refseq | NP_001240838 |
MIM | 603966 |
UniProt ID | P42330 |
◆ Recombinant Proteins | ||
AKR1C3-600R | Recombinant Rat AKR1C3 Protein | +Inquiry |
AKR1C3-3489H | Recombinant Human AKR1C3 protein, His-tagged | +Inquiry |
AKR1C3-140H | Recombinant Human Aldo-keto reductase family 1, member C3, His-tagged | +Inquiry |
AKR1C3-256R | Recombinant Rat AKR1C3 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKR1C3-9533H | Recombinant Human AKR1C3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKR1C3-49HCL | Recombinant Human AKR1C3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AKR1C3 Products
Required fields are marked with *
My Review for All AKR1C3 Products
Required fields are marked with *
0
Inquiry Basket