Active Recombinant Human AKR1C3 Protein
Cat.No. : | AKR1C3-01H |
Product Overview : | Recombinant human AKR1C3 protein (1-323aa, 323aa) without tag was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 1-323 |
Description : | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding different isoforms have been found for this gene. |
Form : | Liquid |
Bio-activity : | Specific activity is > 1000 pmol/min/μg, and is defined as the amount of enzyme that catalyze the oxidation of 1.0 pmole 1-Acenaphthenol in the presence of NADP per minute at pH 8.8 at 25 centigrade. |
Molecular Mass : | 36.8 kDa |
AA Sequence : | MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 90% by SDS-PAGE |
Applications : | Enzyme Activity, SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.5) containing 0.1 M NaCl, 10% glycerol, 1 mM DTT |
Gene Name | AKR1C3 aldo-keto reductase family 1 member C3 [ Homo sapiens (human) ] |
Official Symbol | AKR1C3 |
Synonyms | AKR1C3; aldo-keto reductase family 1 member C3; DD3; DDX; PGFS; HAKRB; HAKRe; HA1753; HSD17B5; hluPGFS; aldo-keto reductase family 1 member C3; 3-alpha hydroxysteroid dehydrogenase, type II; 3-alpha-HSD type II, brain; chlordecone reductase homolog HAKRb; dihydrodiol dehydrogenase 3; dihydrodiol dehydrogenase X; indanol dehydrogenase; prostaglandin F synthase; testosterone 17-beta-dehydrogenase 5; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; type IIb 3-alpha hydroxysteroid dehydrogenase; EC 1.1.1.188; EC 1.1.1.210; EC 1.1.1.239; EC 1.1.1.357; EC 1.1.1.53; EC 1.1.1.62; EC 1.1.1.64 |
Gene ID | 8644 |
mRNA Refseq | NM_003739 |
Protein Refseq | NP_003730 |
MIM | 603966 |
UniProt ID | P42330 |
◆ Recombinant Proteins | ||
AKR1C3-26146TH | Active Recombinant Full Length Human AKR1C3 Protein, His tagged | +Inquiry |
AKR1C3-256R | Recombinant Rat AKR1C3 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKR1C3-140H | Recombinant Human Aldo-keto reductase family 1, member C3, His-tagged | +Inquiry |
AKR1C3-413H | Recombinant Human AKR1C3 Protein, GST-tagged | +Inquiry |
AKR1C3-090H | Recombinant Human AKR1C3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKR1C3-49HCL | Recombinant Human AKR1C3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AKR1C3 Products
Required fields are marked with *
My Review for All AKR1C3 Products
Required fields are marked with *
0
Inquiry Basket