Recombinant Human AKR1C3 protein, GST-tagged

Cat.No. : AKR1C3-9533H
Product Overview : Recombinant Human AKR1C3 protein(1-323 aa), fused with N-terminal GST tag, was expressed in E. coli.
Availability November 26, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-323 aa
Tag : N-GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Gene Name AKR1C3 aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) [ Homo sapiens ]
Official Symbol AKR1C3
Synonyms AKR1C3; aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II); HSD17B5, hydroxysteroid (17 beta) dehydrogenase 5; aldo-keto reductase family 1 member C3; DDX; dihydrodiol dehydrogenase X; HAKRB; KIAA0119; PGFS; prostaglandin F synthase; indanol dehydrogenase; 3-alpha-HSD type II, brain; dihydrodiol dehydrogenase 3; chlordecone reductase homolog HAKRb; testosterone 17-beta-dehydrogenase 5; type IIb 3-alpha hydroxysteroid dehydrogenase; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; DD3; HAKRe; HA1753; HSD17B5; hluPGFS;
Gene ID 8644
mRNA Refseq NM_001253909
Protein Refseq NP_001240838
MIM 603966
UniProt ID P42330

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AKR1C3 Products

Required fields are marked with *

My Review for All AKR1C3 Products

Required fields are marked with *

0
cart-icon
0
compare icon