Recombinant Human AKR1C3 protein, GST-tagged
Cat.No. : | AKR1C3-9533H |
Product Overview : | Recombinant Human AKR1C3 protein(1-323 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | August 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-323 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY |
Gene Name | AKR1C3 aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) [ Homo sapiens ] |
Official Symbol | AKR1C3 |
Synonyms | AKR1C3; aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II); HSD17B5, hydroxysteroid (17 beta) dehydrogenase 5; aldo-keto reductase family 1 member C3; DDX; dihydrodiol dehydrogenase X; HAKRB; KIAA0119; PGFS; prostaglandin F synthase; indanol dehydrogenase; 3-alpha-HSD type II, brain; dihydrodiol dehydrogenase 3; chlordecone reductase homolog HAKRb; testosterone 17-beta-dehydrogenase 5; type IIb 3-alpha hydroxysteroid dehydrogenase; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; DD3; HAKRe; HA1753; HSD17B5; hluPGFS; |
Gene ID | 8644 |
mRNA Refseq | NM_001253909 |
Protein Refseq | NP_001240838 |
MIM | 603966 |
UniProt ID | P42330 |
◆ Recombinant Proteins | ||
AKR1C3-1971HFL | Recombinant Full Length Human AKR1C3 Protein, C-Flag-tagged | +Inquiry |
AKR1C3-1368HF | Recombinant Full Length Human AKR1C3 Protein, GST-tagged | +Inquiry |
AKR1C3-305H | Recombinant Human AKR1C3 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKR1C3-11H | Recombinant Human AKR1C3 protein, His-tagged | +Inquiry |
AKR1C3-090H | Recombinant Human AKR1C3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKR1C3-49HCL | Recombinant Human AKR1C3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKR1C3 Products
Required fields are marked with *
My Review for All AKR1C3 Products
Required fields are marked with *