Recombinant Human CCL21 Protein

Cat.No. : CCL21-19H
Product Overview : Recombinant Human CCL21 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Exodus-2, also known as CCL21 and 6Ckine, is a chemokine that is strongly produced in the human lymph nodes and spleen. Exodus-2 signals through the chemokine receptor CCR7 to regulate thymocyte and activated T cell migration. Exodus-2 also mediates the homing of lymphocytes to the lymphatic system.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 12.3 kDa (111 aa)
AA Sequence : SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name CCL21 chemokine (C-C motif) ligand 21 [ Homo sapiens (human) ]
Official Symbol CCL21
Synonyms CCL21; chemokine (C-C motif) ligand 21; SCYA21, small inducible cytokine subfamily A (Cys Cys), member 21; C-C motif chemokine 21; 6Ckine; beta chemokine exodus 2; CKb9; ECL; Efficient Chemoattractant for Lymphocytes; exodus 2; secondary lymphoid tissue chemokine; SLC; TCA4; exodus-2; beta chemokine exodus-2; beta-chemokine exodus-2; small-inducible cytokine A21; secondary lymphoid-tissue chemokine; small inducible cytokine subfamily A (Cys-Cys), member 21; SCYA21; MGC34555;
Gene ID 6366
mRNA Refseq NM_002989
Protein Refseq NP_002980
MIM 602737
UniProt ID O00585

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL21 Products

Required fields are marked with *

My Review for All CCL21 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon