Recombinant Human CCL21 Protein
Cat.No. : | CCL21-19H |
Product Overview : | Recombinant Human CCL21 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Exodus-2, also known as CCL21 and 6Ckine, is a chemokine that is strongly produced in the human lymph nodes and spleen. Exodus-2 signals through the chemokine receptor CCR7 to regulate thymocyte and activated T cell migration. Exodus-2 also mediates the homing of lymphocytes to the lymphatic system. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 12.3 kDa (111 aa) |
AA Sequence : | SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | CCL21 chemokine (C-C motif) ligand 21 [ Homo sapiens (human) ] |
Official Symbol | CCL21 |
Synonyms | CCL21; chemokine (C-C motif) ligand 21; SCYA21, small inducible cytokine subfamily A (Cys Cys), member 21; C-C motif chemokine 21; 6Ckine; beta chemokine exodus 2; CKb9; ECL; Efficient Chemoattractant for Lymphocytes; exodus 2; secondary lymphoid tissue chemokine; SLC; TCA4; exodus-2; beta chemokine exodus-2; beta-chemokine exodus-2; small-inducible cytokine A21; secondary lymphoid-tissue chemokine; small inducible cytokine subfamily A (Cys-Cys), member 21; SCYA21; MGC34555; |
Gene ID | 6366 |
mRNA Refseq | NM_002989 |
Protein Refseq | NP_002980 |
MIM | 602737 |
UniProt ID | O00585 |
◆ Recombinant Proteins | ||
CCL21-0625H | Active Recombinant Human CCL21 Protein | +Inquiry |
CCL21-2148H | Recombinant Human CCL21 Protein, His-tagged | +Inquiry |
CCL21-151H | Recombinant Human CCL21 Protein, DYKDDDDK-tagged | +Inquiry |
CCL21-2653H | Recombinant Human CCL21 protein, GST-tagged | +Inquiry |
CCL21-10843H | Recombinant Human CCL21, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL21-424CCL | Recombinant Cynomolgus CCL21 cell lysate | +Inquiry |
CCL21-552HCL | Recombinant Human CCL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL21 Products
Required fields are marked with *
My Review for All CCL21 Products
Required fields are marked with *
0
Inquiry Basket