Recombinant Human CD209 protein, Fc-tagged
Cat.No. : | CD209-634H |
Product Overview : | Recombinant Human CD209(Lys62-Ala404) fused with Fc tag at N-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | Lys62-Ala404 |
Form : | Lyophilized from a 0.2 μM filtered solution of PBS, pH7.4 |
AA Sequence : | DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEK SKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVER LCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWM GLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSA ASCSRDEEQFLSPAPATPNPPPA |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Shipping : | The product is shipped at ambient temperature. |
Gene Name | CD209 CD209 molecule [ Homo sapiens ] |
Official Symbol | CD209 |
Synonyms | CD209; CD209 molecule; CD209 antigen; CDSIGN; CLEC4L; DC SIGN; DC SIGN1; HIV gpl20-binding protein; C-type lectin domain family 4 member L; C-type lectin domain family 4, member L; dendritic cell-specific ICAM-3-grabbing non-integrin 1; dendritic cell-specific intracellular adhesion molecules (ICAM)-3 grabbing non-integrin; DC-SIGN; DC-SIGN1; MGC129965; |
Gene ID | 30835 |
mRNA Refseq | NM_001144893 |
Protein Refseq | NP_001138365 |
MIM | 604672 |
UniProt ID | Q9NNX6 |
Chromosome Location | 19p13 |
Pathway | Measles, organism-specific biosystem; Measles, conserved biosystem; Phagosome, organism-specific biosystem; Phagosome, conserved biosystem; Tuberculosis, organism-specific biosystem; Tuberculosis, conserved biosystem; |
Function | mannose binding; metal ion binding; peptide antigen binding; receptor activity; sugar binding; virion binding; |
◆ Recombinant Proteins | ||
CD209-0811H | Recombinant Human CD209 Protein (M1-A404), His/Strep, Flag tagged | +Inquiry |
CD209-3034HF | Recombinant Full Length Human CD209 Protein, GST-tagged | +Inquiry |
RFL7980CF | Recombinant Full Length Chlorocebus Aethiops Cd209 Antigen(Cd209) Protein, His-Tagged | +Inquiry |
CD209-643H | Recombinant Human CD209 protein, His-tagged | +Inquiry |
CD209-0748H | Recombinant Human CD209 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD209-2986HCL | Recombinant Human CD209 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD209 Products
Required fields are marked with *
My Review for All CD209 Products
Required fields are marked with *
0
Inquiry Basket