Recombinant Human CD209 protein, Fc-tagged

Cat.No. : CD209-634H
Product Overview : Recombinant Human CD209(Lys62-Ala404) fused with Fc tag at N-terminal was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc
Protein Length : Lys62-Ala404
Form : Lyophilized from a 0.2 μM filtered solution of PBS, pH7.4
AA Sequence : DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEK SKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVER LCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWM GLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSA ASCSRDEEQFLSPAPATPNPPPA
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping : The product is shipped at ambient temperature.
Gene Name CD209 CD209 molecule [ Homo sapiens ]
Official Symbol CD209
Synonyms CD209; CD209 molecule; CD209 antigen; CDSIGN; CLEC4L; DC SIGN; DC SIGN1; HIV gpl20-binding protein; C-type lectin domain family 4 member L; C-type lectin domain family 4, member L; dendritic cell-specific ICAM-3-grabbing non-integrin 1; dendritic cell-specific intracellular adhesion molecules (ICAM)-3 grabbing non-integrin; DC-SIGN; DC-SIGN1; MGC129965;
Gene ID 30835
mRNA Refseq NM_001144893
Protein Refseq NP_001138365
MIM 604672
UniProt ID Q9NNX6
Chromosome Location 19p13
Pathway Measles, organism-specific biosystem; Measles, conserved biosystem; Phagosome, organism-specific biosystem; Phagosome, conserved biosystem; Tuberculosis, organism-specific biosystem; Tuberculosis, conserved biosystem;
Function mannose binding; metal ion binding; peptide antigen binding; receptor activity; sugar binding; virion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD209 Products

Required fields are marked with *

My Review for All CD209 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon