Recombinant Human FGF23, His-tagged
Cat.No. : | FGF23-27677TH |
Product Overview : | Recombinant full length Human FGF 23 C terminal peptide with an N terminal His tag; 81 amino acids with tag, Predicted MWt 8.67 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 72 amino acids |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The product of this gene inhibits renal tubular phosphate transport. This gene was identified by its mutations associated with autosomal dominant hypophosphatemic rickets (ADHR), an inherited phosphate wasting disorder. Abnormally high level expression of this gene was found in oncogenic hypophosphatemic osteomalacia (OHO), a phenotypically similar disease caused by abnormal phosphate metabolism. Mutations in this gene have also been shown to cause familial tumoral calcinosis with hyperphosphatemia. |
Conjugation : | HIS |
Molecular Weight : | 8.670kDa inclusive of tags |
Tissue specificity : | Expressed in osteogenic cells particularly during phases of active bone remodeling. In adult trabecular bone, expressed in osteocytes and flattened bone-lining cells (inactive osteoblasts). |
Form : | Lyophilised:Add deionized water to prepare a working stock solution of 0.5 mg/ml and let the lyophilized pellet dissolve completely. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80°C for long term storage. Reconsti |
Purity : | by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 50mM Sodium chloride, 20mM Tris, pH 7.5 |
Storage : | Store at -80°C |
Sequences of amino acids : | MKHHHHHHASAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI |
Sequence Similarities : | Belongs to the heparin-binding growth factors family. |
Gene Name | FGF23 fibroblast growth factor 23 [ Homo sapiens ] |
Official Symbol | FGF23 |
Synonyms | FGF23; fibroblast growth factor 23; |
Gene ID | 8074 |
mRNA Refseq | NM_020638 |
Protein Refseq | NP_065689 |
MIM | 605380 |
Uniprot ID | Q9GZV9 |
Chromosome Location | 12p13 |
Pathway | Downstream signaling of activated FGFR, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR1 ligand binding and activation, organism-specific biosystem; FGFR1c and Klotho ligand binding and activation, organism-specific biosystem; |
Function | growth factor activity; protein tyrosine kinase activity; type 1 fibroblast growth factor receptor binding; |
◆ Recombinant Proteins | ||
FGF23-3589H | Recombinant Human FGF23 Protein (Ser180-Ile251), N-His tagged | +Inquiry |
FGF23-1990R | Recombinant Rat FGF23 Protein, His (Fc)-Avi-tagged | +Inquiry |
Fgf23-7408M | Active Recombinant Mouse Fgf23 Protein | +Inquiry |
Fgf23-493R | Recombinant Rat Fgf23 protein, His-tagged | +Inquiry |
FGF23-4112H | Recombinant Human FGF23 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF23-6241HCL | Recombinant Human FGF23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF23 Products
Required fields are marked with *
My Review for All FGF23 Products
Required fields are marked with *
0
Inquiry Basket