Recombinant Human ICOS Protein, Fc-tagged
Cat.No. : | ICOS-672H |
Product Overview : | Recombinant human ICOS protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 199 |
Description : | The protein encoded by this gene belongs to the CD28 and CTLA-4 cell-surface receptor family. It forms homodimers and plays an important role in cell-cell signaling, immune responses, and regulation of cell proliferation. |
Form : | Lyophilized |
Molecular Mass : | 40.4 kDa |
AA Sequence : | MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | ICOS inducible T-cell co-stimulator [ Homo sapiens (human) ] |
Official Symbol | ICOS |
Synonyms | ICOS; inducible T-cell co-stimulator; inducible T-cell costimulator; activation inducible lymphocyte immunomediatory molecule; AILIM; CD278; inducible costimulator; activation-inducible lymphocyte immunomediatory molecule; CVID1; MGC39850; |
Gene ID | 29851 |
mRNA Refseq | NM_012092 |
Protein Refseq | NP_036224 |
MIM | 604558 |
UniProt ID | Q9Y6W8 |
◆ Recombinant Proteins | ||
ICOS-3472H | Recombinant Human ICOS Protein (Glu21-Phe141), C-Fc tagged | +Inquiry |
Icos-8799RAF555 | Recombinant Rat Icos Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
ICOS-729M | Recombinant Mouse ICOS protein (C137S, C138S), Fc-tagged | +Inquiry |
Icos-4933R | Recombinant Rat Icos protein, His-tagged | +Inquiry |
Icos-6951MAF555 | Recombinant Mouse Icos Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
ICOS-1195RCL | Recombinant Rat ICOS cell lysate | +Inquiry |
ICOS-1724MCL | Recombinant Mouse ICOS cell lysate | +Inquiry |
ICOS-2444HCL | Recombinant Human ICOS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ICOS Products
Required fields are marked with *
My Review for All ICOS Products
Required fields are marked with *
0
Inquiry Basket