Recombinant Human ICOS Protein, His&Fc tagged

• Cat.No.: ICOS-44H
• Product Overview: Recombinant human ICOS (21-140 aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: Insect Cells
• Tag: Fc&His
• Protein Length: 21-140 aa
• Description: The protein encoded by this gene belongs to the CD28 and CTLA-4 cell-surface receptor family. It forms homodimers and plays an important role in cell-cell signaling, immune responses, and regulation of cell proliferation.
• Form: Liquid
• AASequence: EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK
• Molecular Mass: 40.8 kDa
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Storage Buffer: 20mM MES buffer (pH 5.5) containing 40% glycerol, 2mM DTT, 1mM EDTA 0.1M NaCl
• Concentration: 0.25 mg/mL (determined by absorbance at 280nm)

Gene Information

• Gene ID: 29851
• Gene Name: ICOS inducible T-cell co-stimulator [ Homo sapiens (human) ]
• Official Symbol: ICOS
• Synonyms: ICOS; inducible T-cell co-stimulator; inducible T-cell costimulator; activation inducible lymphocyte immunomediatory molecule; AILIM; CD278; inducible costimulator; activation-inducible lymphocyte immunomediatory molecule; CVID1; MGC39850
• mRNA Refseq: NM_012092
• Protein Refseq: NP_036224
• MIM: 604558
• UniProt ID: Q9Y6W8