Recombinant Human ICOS Protein, His&Fc tagged

Cat.No. : ICOS-44H
Product Overview : Recombinant human ICOS (21-140 aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : Fc&His
Protein Length : 21-140 aa
Description : The protein encoded by this gene belongs to the CD28 and CTLA-4 cell-surface receptor family. It forms homodimers and plays an important role in cell-cell signaling, immune responses, and regulation of cell proliferation.
Form : Liquid
AASequence : EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK
Molecular Mass : 40.8 kDa
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Storage Buffer : 20mM MES buffer (pH 5.5) containing 40% glycerol, 2mM DTT, 1mM EDTA 0.1M NaCl
Concentration : 0.25 mg/mL (determined by absorbance at 280nm)
Gene ID 29851
Gene Name ICOS inducible T-cell co-stimulator [ Homo sapiens (human) ]
Official Symbol 29851
Synonyms ICOS; inducible T-cell co-stimulator; inducible T-cell costimulator; activation inducible lymphocyte immunomediatory molecule; AILIM; CD278; inducible costimulator; activation-inducible lymphocyte immunomediatory molecule; CVID1; MGC39850;
mRNA Refseq NM_012092
Official Symbol 2 ICOS
Gene ID 2 29851
Gene Name 2 ICOS inducible T-cell co-stimulator [ Homo sapiens (human) ]
mRNA Refseq 2 NM_012092
Protein Refseq 2 NP_036224
MIM 2 604558
UniProt ID 2 Q9Y6W8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ICOS Products

Required fields are marked with *

My Review for All ICOS Products

Required fields are marked with *

0
cart-icon
0
compare icon