Recombinant Cat IL13 protein(34-144aa), His-tagged
Cat.No. : | IL13-3170C |
Product Overview : | Recombinant Cat IL13 protein(A0A2I2UTQ7)(34-144aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cat |
Source : | E.coli |
Tag : | His |
Protein Length : | 34-144aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.5 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | PGPHSRRELKELIEELVNITQNQVSLCNGSMVWSVNLTTGMYCAALESLINVSDCTAIQRTQRMLKALCTQKPSAGQTASERSRDTKIEVIQLVKNLLNHLRRNFRHGNFK |
◆ Recombinant Proteins | ||
Il13-038I | Active Recombinant Mouse Il13 Protein (111 aa) | +Inquiry |
IL13-328H | Active Recombinant Human IL13 | +Inquiry |
IL13-60M | Recombinant Mouse IL-13 | +Inquiry |
Il13-49M | Active Recombinant Mouse Il13 Protein (Pro22-Fhe131), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL13-365H | Active Recombinant Human IL13 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL13-1894CCL | Recombinant Cynomolgus IL13 cell lysate | +Inquiry |
IL13-2922HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-001HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-1336MCL | Recombinant Mouse IL13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL13 Products
Required fields are marked with *
My Review for All IL13 Products
Required fields are marked with *