Recombinant Human RNASE2 Protein, GST-tagged
Cat.No. : | RNASE2-02H |
Product Overview : | Human RNASE2 full-length ORF ( NP_002925.1, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal was expressed in wheat germ (in vitro). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a non-secretory ribonuclease that belongs to the pancreatic ribonuclease family, a subset of the ribonuclease A superfamily. The protein antimicrobial activity against viruses. |
Molecular Mass : | 44.8 kDa |
AA Sequence : | MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | RNASE2 ribonuclease A family member 2 [ Homo sapiens (human) ] |
Official Symbol | RNASE2 |
Synonyms | RNASE2; ribonuclease A family member 2; EDN; RAF3; RNS2; non-secretory ribonuclease; RNase 2; RNase UpI-2; eosinophil-derived neurotoxin; ribonuclease 2; ribonuclease A F3; ribonuclease US; ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin); EC 4.6.1.18 |
Gene ID | 6036 |
mRNA Refseq | NM_002934 |
Protein Refseq | NP_002925 |
MIM | 131410 |
UniProt ID | P10153 |
◆ Recombinant Proteins | ||
RNASE2-2832H | Recombinant Human RNASE2 Protein, His-tagged, OVA Conjugated | +Inquiry |
RNASE2-03H | Recombinant Human RNASE2 protein, His-tagged | +Inquiry |
RNASE2-1210H | Recombinant Human RNASE2 Protein, His&SUMO-tagged | +Inquiry |
RNASE2-4938H | Recombinant Human RNASE2 protein(28-161aa), hFc-tagged | +Inquiry |
RNASE2-02H | Recombinant Human RNASE2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
RNASE2-171H | Native Human Eosinophil Derived Neurotoxin | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNASE2-1514HCL | Recombinant Human RNASE2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNASE2 Products
Required fields are marked with *
My Review for All RNASE2 Products
Required fields are marked with *
0
Inquiry Basket