Recombinant Human RNASE2 protein(28-161aa), hFc-tagged

Cat.No. : RNASE2-4938H
Product Overview : Recombinant Human RNASE2 protein(P10153)(28-161aa), fused with C-terminal hFc tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc
Protein Length : 28-161aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 44.4 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
Gene Name RNASE2 ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin) [ Homo sapiens ]
Official Symbol RNASE2
Synonyms RNASE2; ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin); RNS2; non-secretory ribonuclease; EDN; RNase 2; RNase UpI-2; ribonuclease 2; ribonuclease US; eosinophil-derived neurotoxin;
Gene ID 6036
mRNA Refseq NM_002934
Protein Refseq NP_002925
MIM 131410
UniProt ID P10153

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNASE2 Products

Required fields are marked with *

My Review for All RNASE2 Products

Required fields are marked with *

0
cart-icon