Recombinant Human RNASE2 Protein (28-161 aa), His-tagged

• Cat.No.: RNASE2-779H
• Product Overview: Recombinant Human RNASE2 Protein (28-161 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 28-161 aa
• Description: This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chotactic for dendritic cells. Possesses a wide variety of biological activities.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 19.5 kDa
• AA Sequence: KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: RNASE2 ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin) [ Homo sapiens ]
• Official Symbol: RNASE2
• Synonyms: RNASE2; RNS2; EDN; RNase 2; RNase UpI-2; ribonuclease 2; ribonuclease US
• Gene ID: 6036
• mRNA Refseq: NM_002934
• Protein Refseq: NP_002925
• MIM: 131410
• UniProt ID: P10153