"RNASE2" Related Products

Recombinant Human RNASE2 Protein (28-161 aa), His-tagged

Cat.: RNASE2-779H
Cat.No.: RNASE2-779H
Product Overview: Recombinant Human RNASE2 Protein (28-161 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein.
Description: This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chotactic for dendritic cells. Possesses a wide variety of biological activities.
Source: E. coli
Species: Human
Tag : His
Form: Tris-based buffer, 50% glycerol
Molecular Mass: 19.5 kDa
Protein length: 28-161 aa
AA Sequence: KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
Purity: > 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration: A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name: RNASE2 ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin) [ Homo sapiens ]
Official Symbol: RNASE2
Synonyms: RNASE2; RNS2; EDN; RNase 2; RNase UpI-2; ribonuclease 2; ribonuclease US;
Gene ID: 6036
mRNA Refseq: NM_002934
Protein Refseq: NP_002925
MIM: 131410
UniProt ID: P10153

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.