Recombinant Human RNASE2 Protein (28-161 aa), His-tagged
Cat.No. : | RNASE2-779H |
Product Overview : | Recombinant Human RNASE2 Protein (28-161 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 28-161 aa |
Description : | This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chotactic for dendritic cells. Possesses a wide variety of biological activities. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 19.5 kDa |
AA Sequence : | KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | RNASE2 ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin) [ Homo sapiens ] |
Official Symbol | RNASE2 |
Synonyms | RNASE2; RNS2; EDN; RNase 2; RNase UpI-2; ribonuclease 2; ribonuclease US; |
Gene ID | 6036 |
mRNA Refseq | NM_002934 |
Protein Refseq | NP_002925 |
MIM | 131410 |
UniProt ID | P10153 |
◆ Recombinant Proteins | ||
RNASE2-01H | Recombinant Human RNASE2 Protein, GST-tagged | +Inquiry |
Rnase2-2020R | Recombinant Rat Rnase2 Protein, His-tagged | +Inquiry |
RNASE2-03H | Recombinant Human RNASE2 protein, His-tagged | +Inquiry |
RNASE2-4938H | Recombinant Human RNASE2 protein(28-161aa), hFc-tagged | +Inquiry |
RNASE2-6875HF | Recombinant Full Length Human RNASE2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
RNASE2-171H | Native Human Eosinophil Derived Neurotoxin | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNASE2-1514HCL | Recombinant Human RNASE2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNASE2 Products
Required fields are marked with *
My Review for All RNASE2 Products
Required fields are marked with *