Recombinant Human RNASE2 protein, His-tagged
Cat.No. : | RNASE2-356H |
Product Overview : | Recombinant Human RNASE2 protein(P10153)(28-161aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 28-161aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.0 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII |
Gene Name | RNASE2 ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin) [ Homo sapiens ] |
Official Symbol | RNASE2 |
Synonyms | RNASE2; ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin); RNS2; non-secretory ribonuclease; EDN; RNase 2; RNase UpI-2; ribonuclease 2; ribonuclease US; eosinophil-derived neurotoxin; |
Gene ID | 6036 |
mRNA Refseq | NM_002934 |
Protein Refseq | NP_002925 |
MIM | 131410 |
UniProt ID | P10153 |
◆ Recombinant Proteins | ||
Rnase2-2020R | Recombinant Rat Rnase2 Protein, His-tagged | +Inquiry |
RNASE2-2832H | Recombinant Human RNASE2 Protein, His-tagged, OVA Conjugated | +Inquiry |
RNASE2-779H | Recombinant Human RNASE2 Protein (28-161 aa), His-tagged | +Inquiry |
RNASE2-1210H | Recombinant Human RNASE2 Protein, His&SUMO-tagged | +Inquiry |
RNASE2-6875HF | Recombinant Full Length Human RNASE2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
RNASE2-171H | Native Human Eosinophil Derived Neurotoxin | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNASE2-1514HCL | Recombinant Human RNASE2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNASE2 Products
Required fields are marked with *
My Review for All RNASE2 Products
Required fields are marked with *