Recombinant Mouse IL16 Protein
| Cat.No. : | IL16-136M |
| Product Overview : | Recombinant Mouse IL16 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Description : | Interleukin 16 (IL-16) is produced by CD4+ and CD8+ T cells and functions as a chemoattractant for lymphocytes, monocytes, eosinophils, dendritic cells, and Langerhans cells. |
| Bio-activity : | No biological activity data is available at this time. |
| AA Sequence : | MHDLNSSTDSAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGDRTGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS |
| Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
| Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : | Storage Prior to Reconstitution: |
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
| Reconstitution : | Sterile water at 0.1 mg/mL |
| Shipping : | Room temperature |
| Gene Name | Il16 interleukin 16 [ Mus musculus (house mouse) ] |
| Official Symbol | IL16 |
| Synonyms | IL16; interleukin 16; pro-interleukin-16; mKIAA4048; KIAA4048; |
| Gene ID | 16170 |
| mRNA Refseq | NM_010551 |
| Protein Refseq | NP_034681 |
| UniProt ID | O54824 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL16 Products
Required fields are marked with *
My Review for All IL16 Products
Required fields are marked with *
