Recombinant Mouse IL16 Protein

Cat.No. : IL16-136M
Product Overview : Recombinant Mouse IL16 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Interleukin 16 (IL-16) is produced by CD4+ and CD8+ T cells and functions as a chemoattractant for lymphocytes, monocytes, eosinophils, dendritic cells, and Langerhans cells.
Bio-activity : No biological activity data is available at this time.
AA Sequence : MHDLNSSTDSAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGDRTGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution:
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Gene Name Il16 interleukin 16 [ Mus musculus (house mouse) ]
Official Symbol IL16
Synonyms IL16; interleukin 16; pro-interleukin-16; mKIAA4048; KIAA4048;
Gene ID 16170
mRNA Refseq NM_010551
Protein Refseq NP_034681
UniProt ID O54824

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL16 Products

Required fields are marked with *

My Review for All IL16 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon