Recombinant Mouse IL16 Protein
Cat.No. : | IL16-136M |
Product Overview : | Recombinant Mouse IL16 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Interleukin 16 (IL-16) is produced by CD4+ and CD8+ T cells and functions as a chemoattractant for lymphocytes, monocytes, eosinophils, dendritic cells, and Langerhans cells. |
Bio-activity : | No biological activity data is available at this time. |
AA Sequence : | MHDLNSSTDSAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGDRTGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Gene Name | Il16 interleukin 16 [ Mus musculus (house mouse) ] |
Official Symbol | IL16 |
Synonyms | IL16; interleukin 16; pro-interleukin-16; mKIAA4048; KIAA4048; |
Gene ID | 16170 |
mRNA Refseq | NM_010551 |
Protein Refseq | NP_034681 |
UniProt ID | O54824 |
◆ Recombinant Proteins | ||
IL16-2174H | Recombinant Human IL16 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IL16-1165H | Recombinant Human IL16 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL16-2865H | Recombinant Human IL16 protein(1211-1330 aa), C-His-tagged | +Inquiry |
IL16-504H | Recombinant Human IL16 protein | +Inquiry |
IL16-181H | Recombinant Human IL16 Protein (Met1203-Ser1332), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Native Proteins | ||
IL16-29736TH | Native Human IL16 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL16-5245HCL | Recombinant Human IL16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL16 Products
Required fields are marked with *
My Review for All IL16 Products
Required fields are marked with *
0
Inquiry Basket