Recombinant Mouse IL16 Protein

• Cat.No.: IL16-136M
• Product Overview: Recombinant Mouse IL16 Protein without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Interleukin 16 (IL-16) is produced by CD4+ and CD8+ T cells and functions as a chemoattractant for lymphocytes, monocytes, eosinophils, dendritic cells, and Langerhans cells.
• Bio-activity: No biological activity data is available at this time.
• AA Sequence: MHDLNSSTDSAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGDRTGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution:
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature

Gene Information

• Gene Name: Il16 interleukin 16 [ Mus musculus (house mouse) ]
• Official Symbol: IL16
• Synonyms: IL16; interleukin 16; pro-interleukin-16; mKIAA4048; KIAA4048
• Gene ID: 16170
• mRNA Refseq: NM_010551
• Protein Refseq: NP_034681
• UniProt ID: O54824