Recombinant Rhesus IL16 protein

Cat.No. : IL16-543R
Product Overview : Recombinant Rhesus IL16 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : E.coli
Tag : Non
Protein Length : 121
Description : Interleukin-16 (IL-16) is also called lymphocyte chemoattractant factor (LCF) and it is mostly secreted by lymphocytes, epithelial cells, eosinophils, and CD8+ T cells. It has many functions including induction of the IL-2Rα on T cells, suppression of human immunodeficiency virus (HIV) replication, inhibition of T-cell antigen receptor/CD3 mediated T-cell stimulation in mixed lymphocyte reactions and so on. It signals through CD4 receptor. Furthermore, recombinant rhesus macaque interleukin-16 contains 121 amino acid residues and it shares 85 % ~ 95 % a.a. sequence identity with human and murine IL-16.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral T lymphocytes is in a concentration range of 1.0-100 ng/ml.
Molecular Mass : Approximately 12.5 kDa, a single non-glycosylated polypeptide chain containing 121 amino acids.
AA Sequence : SAASASAASDVSVESSAEATVYTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETIQPGDEILQLAGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQPKETTAAADS
Endotoxin : Less than 1 EU/µg of rRhIL-16 as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name IL16
Official Symbol IL16
Synonyms Interleukin-16, Lymphocyte Chemoattractant Factor, LCF
Gene ID 574100
mRNA Refseq NM_001374447.1
Protein Refseq NP_001361376.1
UniProt ID O62675

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL16 Products

Required fields are marked with *

My Review for All IL16 Products

Required fields are marked with *

0
cart-icon
0
compare icon