Native Human IL16 IL16-29736TH

Native Human IL16

PRODUCTS

Home / Products / Native Proteins / Native Human IL16

Native Human IL16

Online Inquiry

IL16 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : IL16-29736TH Optional Service: Optional requirements on this protein
Product Overview : Synthetic peptide (Human)
Description : The protein encoded by this gene is a pleiotropic cytokine that functions as a chemoattractant, a modulator of T cell activation, and an inhibitor of HIV replication. The signaling process of this cytokine is mediated by CD4. The product of this gene undergoes proteolytic processing, which is found to yield two functional proteins. The cytokine function is exclusively attributed to the secreted C-terminal peptide, while the N-terminal product may play a role in cell cycle control. Caspase 3 is reported to be involved in the proteolytic processing of this protein. Alternate splicing results in multiple transcript variants.
Source : E. coli
Tissue specificity : Isoform 3 is expressed in hemopoietic tissues, such as resting T-cells, but is undetectable during active T cell proliferation.
Form : Lyophilised:Reconstitute with distilled water to achieve desired concentration.
Storage buffer : Preservative: NoneConstituents: 5mM Sodium citrate, 0.5mM DTT, pH 5.5
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : Recombinant Human IL-16 is a 13.5 kDa protein containing 130 amino acid residues.:MPDLNSSTDSAASASAASDVSVESTAEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFE AWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS
Sequence Similarities : Contains 4 PDZ (DHR) domains.
Gene Name : IL16 interleukin 16 [ Homo sapiens ]
Official Symbol : IL16
Synonyms : IL16; interleukin 16; interleukin 16 (lymphocyte chemoattractant factor); pro-interleukin-16; FLJ16806; FLJ42735; HsT19289; IL 16; LCF; lymphocyte chemoattractant factor; prIL 16; prointerleukin 16;
Gene ID : 3603
mRNA Refseq : NM_001172128
Protein Refseq : NP_001165599
MIM : 603035
Uniprot ID : Q14005
Chromosome Location : 15q26.3
Function : cytokine activity;
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry


  • Note: There will be extra charge for optional service!

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2023 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy