Recombinant Mouse Il5ra Protein, His-tagged
Cat.No. : | Il5ra-7244M |
Product Overview : | Recombinant Mouse Il5ra Protein with a His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Tag : | His |
Protein Length : | 18-339 |
Description : | This is the receptor for interleukin-5. The alpha chain binds to IL5. |
Form : | Liquid |
Molecular Mass : | 37.8 kDa |
AA Sequence : | DLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVGKERKSLVEWHLEHHHHHH |
Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol. |
Gene Name | Il5ra interleukin 5 receptor, alpha [ Mus musculus (house mouse) ] |
Official Symbol | Il5ra |
Synonyms | Il5ra; interleukin 5 receptor, alpha; I; Il5r; CD125; CDw125; interleukin-5 receptor subunit alpha; IL-5 receptor alpha chain; IL-5 receptor subunit alpha; IL-5R subunit alpha |
Gene ID | 16192 |
mRNA Refseq | NM_008370 |
Protein Refseq | NP_032396 |
UniProt ID | P21183 |
◆ Recombinant Proteins | ||
IL5Ra-431M | Recombinant Mouse IL5Ra protein, His-tagged | +Inquiry |
Il5ra-1245M | Recombinant Mouse Il5ra Protein, MYC/DDK-tagged | +Inquiry |
IL5RA-127H | Active Recombinant Human Interleukin 5 Receptor, Alpha, 322aa, Fc Chimera | +Inquiry |
IL5RA-27608TH | Recombinant Human IL5RA | +Inquiry |
IL5RA-126H | Recombinant Human Interleukin 5 receptor, Alpha, 308aa, Fc Chimera | +Inquiry |
◆ Native Proteins | ||
IL5RA-620C | Recombinant Cynomolgus IL5RA Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL5RA-2060HCL | Recombinant Human IL5RA cell lysate | +Inquiry |
IL5RA-001MCL | Recombinant Mouse IL5RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il5ra Products
Required fields are marked with *
My Review for All Il5ra Products
Required fields are marked with *
0
Inquiry Basket