Recombinant Mouse Lgals3 Protein, His-tagged

Cat.No. : Lgals3-7260M
Product Overview : Recombinant mouse LGALS3 protein, used to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-264
Description : Biased expression in colon adult (RPKM 931.1), duodenum adult (RPKM 311.5) and 8 other tissues.
Form : Liquid
Molecular Mass : 29.8 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSMADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGSTAPGAFPGQPGAPGAYPSAPGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI
Purity : > 95 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.5 mg/mL (determined by Bradford assay)
Storage Buffer : 20 mM Tris-HCl buffer (pH 8.0) containing 0.15 M NaCl, 50 % glycerol,1 mM DTT, 2 mM EDTA
Gene Name Lgals3 lectin, galactose binding, soluble 3 [ Mus musculus (house mouse) ]
Official Symbol Lgals3
Synonyms Lgals3; lectin, galactose binding, soluble 3; ga; GBP; L-3; L-34; Mac-; gal3; Mac-2; galect; galectin-3; 35 kDa lectin; CBP 35; L-34 galactoside-binding lectin; carbohydrate-binding protein 35; gal-3; galactose-specific lectin 3; igE-binding protein; laminin-binding protein; lectin L-29; mac-2 antigen
Gene ID 16854
mRNA Refseq NM_001145953
Protein Refseq NP_001139425
UniProt ID Q8C253

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Lgals3 Products

Required fields are marked with *

My Review for All Lgals3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon