Recombinant Human LGALS3 protein, GST-tagged
Cat.No. : | LGALS3-453H |
Product Overview : | Recombinant Human LGALS3(1 - 250 aa) fused with GST tag was expressed in E. coli. |
Availability | September 14, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1 - 250 aa |
Description : | This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2014] Annotation information Note: GeneID 3958 had the official symbol LGALS2 and was identified as the human homolog of mouse Mac-2 (macrophage galactose-specific lectin) in M35368.1 and PMID: 2402511. The official symbol for this gene is now LGALS3. |
Form : | Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization. |
AA Sequence : | MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI |
Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder. Storage of Reconstituted Protein: Short-term storage: Store at 2-8 centigrade for two weeks. Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | LGALS3 lectin, galactoside-binding, soluble, 3 [ Homo sapiens ] |
Official Symbol | LGALS3 |
Synonyms | LGALS3; lectin, galactoside-binding, soluble, 3; LGALS2; galectin-3; galectin 3; GALIG; MAC 2; lectin L-29; 35 kDa lectin; MAC-2 antigen; IgE-binding protein; laminin-binding protein; galactose-specific lectin 3; carbohydrate-binding protein 35; L31; GAL3; MAC2; CBP35; GALBP; |
Gene ID | 3958 |
mRNA Refseq | NM_001177388 |
Protein Refseq | NP_001170859 |
MIM | 153619 |
UniProt ID | P17931 |
Chromosome Location | 14q22.3 |
Pathway | Advanced glycosylation endproduct receptor signaling, organism-specific biosystem; Hedgehog signaling events mediated by Gli proteins, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; |
Function | IgE binding; protein binding; sugar binding; |
◆ Recombinant Proteins | ||
LGALS3-1459C | Recombinant Cynomolgus LGALS3 protein, His-tagged | +Inquiry |
LGALS3-2604H | Active Recombinant Human LGALS3 protein | +Inquiry |
LGALS3-6977H | Recombinant Human LGALS3 protein(Met1-Ile250) | +Inquiry |
LGALS3-7142C | Recombinant Chicken LGALS3 | +Inquiry |
Lgals3-343R | Recombinant Rat Lgals3 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LGALS3-6914H | Active Recombinant Human LGALS3 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGALS3-4766HCL | Recombinant Human LGALS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGALS3 Products
Required fields are marked with *
My Review for All LGALS3 Products
Required fields are marked with *