Recombinant Rat IL17A Protein
Cat.No. : | IL17A-141R |
Product Overview : | Recombinant Rat IL17A Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Description : | Interleukin 17A (IL-17A), also known as CTLA-8, is a member of the IL-17 family of proteins. IL-17A is proinflammatory cytokine that is secreted by activated |
Bio-activity : | No biological activity data is available at this time. |
AA Sequence : | MAVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium citrate, pH 3.0 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Gene Name | Il17a interleukin 17A [ Rattus norvegicus (Norway rat) ] |
Official Symbol | IL17A |
Synonyms | IL17A; interleukin 17A; interleukin-17A; cytotoxic T-lymphocyte-associated antigen 8; Interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); Il17; IL-17; CTLA-8; IL-17A; |
Gene ID | 301289 |
mRNA Refseq | NM_001106897 |
Protein Refseq | NP_001100367 |
UniProt ID | Q61453 |
◆ Recombinant Proteins | ||
IL17A-487H | Active Recombinant Human Interleukin 17A | +Inquiry |
IL17A-2293H | Recombinant Human IL17A Protein, His-tagged | +Inquiry |
IL17A-27H | Active Recombinant Human IL17A Protein, Animal Free | +Inquiry |
IL17A-139M | Active Recombinant Mouse IL17A Protein | +Inquiry |
IL17A-001C | Recombinant Cynomolgus Monkey IL17A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL17A Products
Required fields are marked with *
My Review for All IL17A Products
Required fields are marked with *
0
Inquiry Basket