Recombinant Rat IL17A Protein

Cat.No. : IL17A-141R
Product Overview : Recombinant Rat IL17A Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Description : Interleukin 17A (IL-17A), also known as CTLA-8, is a member of the IL-17 family of proteins. IL-17A is proinflammatory cytokine that is secreted by activated
Bio-activity : No biological activity data is available at this time.
AA Sequence : MAVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution:
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium citrate, pH 3.0
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Gene Name Il17a interleukin 17A [ Rattus norvegicus (Norway rat) ]
Official Symbol IL17A
Synonyms IL17A; interleukin 17A; interleukin-17A; cytotoxic T-lymphocyte-associated antigen 8; Interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); Il17; IL-17; CTLA-8; IL-17A;
Gene ID 301289
mRNA Refseq NM_001106897
Protein Refseq NP_001100367
UniProt ID Q61453

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL17A Products

Required fields are marked with *

My Review for All IL17A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon