Recombinant Human IL17A protein
Cat.No. : | IL17A-122H |
Product Overview : | Recombinant Human IL17A protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 132 |
Description : | Human Interleukin-17A (IL-17A) is encoded by the IL17A gene located on the chromosome 6 and belongs to the IL-17 family that contains IL-17A, IL-17B, IL-17C, IL-17D, IL-17E and IL-17F. They have a similar protein structure, with four highly conserved cysteine residues critical to their 3-dimensional shape, but no sequence similarity to any other known cytokines. Interleukin 17 is a T cell-expressed pleiotropic cytokine that exhibits a high degree of homology to a protein encoded by the ORF13 gene of herpesvirus Saimiri. Mature IL-17 containing one potential N-linked glycosylation site. Both recombinant and natural IL-17 have been shown to exist as disulfide linked homodimers. At the amino acid level, IL-17 exhibits 63 % amino acid identity with mouse IL-17. High levels of human IL-17 were induced from primary peripheral blood CD4+ T cells upon stimulation and they can induce stromal cells to produce proinflammatory and hematopoietic cytokines. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion of murine NIH/3T3 cells is less than 7.5 ng/ml, corresponding to a specific activity of > 1.3 × 10⁵ IU/mg. |
Molecular Mass : | Approximately 31.0 kDa, a disulfide-linked homodimer of two 132 amino acid polypeptide chains. |
AA Sequence : | GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
Endotoxin : | Less than 1 EU/µg of rHuIL-17 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 4 mM HCl to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IL17A |
Official Symbol | IL17A |
Synonyms | IL17A; interleukin 17A; CTLA8, IL17, interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8); interleukin-17A; cytotoxic T lymphocyte associated protein 8; IL 17; IL 17A; CTLA-8; cytotoxic T-lymphocyte-associated antigen 8; cytotoxic T-lymphocyte-associated protein 8; cytotoxic T-lymphocyte-associated serine esterase 8; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); IL17; CTLA8; IL-17; IL-17A; |
Gene ID | 3605 |
mRNA Refseq | NM_002190 |
Protein Refseq | NP_002181 |
MIM | 603149 |
UniProt ID | Q16552 |
◆ Recombinant Proteins | ||
IL17A-508M | Recombinant Mouse IL17A Protein | +Inquiry |
IL17A-572H | Active Recombinant Human Interleukin 17A, HIgG1 Fc-tagged | +Inquiry |
IL17A-872R | Recombinant Rabbit IL17A protein, His-tagged | +Inquiry |
Il17a-678M | Recombinant Mouse Il17a protein, His-Avi-tagged | +Inquiry |
Il17a-89R | Recombinant Rat Interleukin 17A | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL17A Products
Required fields are marked with *
My Review for All IL17A Products
Required fields are marked with *
0
Inquiry Basket